Citrus Sinensis ID: 045385

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MEGASNGGMLYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVWDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHLSKFYLSAYLDSLKGFGWSIFIVRGNFPKECPISSSDSSN
cccccccccEEEEEcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHcccEEEEcccccccccccccccHHHEEEcccccEEEEEEEccEEEEccccccccCEccHHHHHHHHHHHHHccEEEEEEEcccccccccccccccc
*********LYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRS*****************FLTEESHNVSLDGDFSIQVLQKALEVWDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHLSKFYLSAYLDSLKGFGWSIFIVRGNFPKEC*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGASNGGMLYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVWDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHLSKFYLSAYLDSLKGFGWSIFIVRGNFPKECPISSSDSSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ataxin-3 homolog Interacts with key regulators of transcription and represses transcription. Acts as a histone-binding protein that regulates transcription. Acts as a deubiquitinating enzyme.probableQ9M391
Putative ataxin-3 homolog Interacts with key regulators of transcription and represses transcription. Acts as a histone-binding protein that regulates transcription. Acts as a deubiquitinating enzyme.probableQ8LQ36

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O65, chain A
Confidence level:very confident
Coverage over the Query: 9-178
View the alignment between query and template
View the model in PyMOL