Citrus Sinensis ID: 045409

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MGFSHHLQEIVAFYAFIFSIICVYVATSIAKRNKKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFSTPAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIDTNADDQESKRFQKALRDFLYLLGLFLASDNIPFLGWLDTVKGYT
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHHcccccccccccccccccEEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHcccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccHHHHcccccccHHHHHHHHHHcccEEEEEcccccEEEEccHHHHHHHHHHccHHHcccccEEEEccccEEEccccHHHHHHHHHHHHHHHcHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccc
MGFSHHLQEIVAFYAFIFSIICVYVATSIAkrnkkggrkppeaagawpcvghlhllagSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFStndklfstpaklmgydhaiigfapyGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIidtnaddqESKRFQKALRDFLYLLGLflasdnipflgwldtvkgyt
MGFSHHLQEIVAFYAFIFSIICVYVATSIAKRNKKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFSTPAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEqcakngghvAVEMKERFKDLAMNIIDTNADDQESKRFQKALRDFLYLLGLFlasdnipflgwLDTVKGYT
MGFSHHLQEIVAFYAFIFSIICVYVATSIAKRNKKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFSTPAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIDTNADDQESKRFQKAlrdflyllglflASDNIPFLGWLDTVKGYT
*****HLQEIVAFYAFIFSIICVYVATSIA*************AGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFSTPAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIDTN*******RFQKALRDFLYLLGLFLASDNIPFLGWLDTVK***
*****HLQEIVAFYAFIFSIICVYVAT*******************WPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFSTPAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELH***********VEMKERFKDLAMNIIDTNADDQESKRFQKALRDFLYLLGLFLASDNIPFLGWLDTVKGYT
MGFSHHLQEIVAFYAFIFSIICVYVATSIA************AAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFSTPAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIDTNADDQESKRFQKALRDFLYLLGLFLASDNIPFLGWLDTVKGYT
*GFSHHLQEIVAFYAFIFSIICVYVATSIAKRNKKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFSTPAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIDTNADDQESKRFQKALRDFLYLLGLFLASDNIPFLGWLDTVKGYT
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
ooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
ooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFSHHLQEIVAFYAFIFSIICVYVATSIAKRNKKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFSTPAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIDTNADDQESKRFQKALRDFLYLLGLFLASDNIPFLGWLDTVKGYT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query237 2.2.26 [Sep-21-2011]
O49394 523 Cytochrome P450 82C2 OS=A yes no 0.805 0.365 0.448 2e-48
Q9SZ46 524 Cytochrome P450 82C4 OS=A no no 0.805 0.364 0.455 8e-48
Q43068 544 Cytochrome P450 82A1 (Fra N/A no 0.814 0.354 0.407 2e-44
O81972 522 Cytochrome P450 82A2 OS=G no no 0.831 0.377 0.412 9e-41
O49858 527 Cytochrome P450 82A3 OS=G no no 0.894 0.402 0.387 3e-40
O49859 525 Cytochrome P450 82A4 OS=G no no 0.919 0.415 0.372 2e-38
O49396 512 Cytochrome P450 82C3 OS=A no no 0.759 0.351 0.396 3e-37
Q9LSF8 515 Cytochrome P450 82G1 OS=A no no 0.793 0.365 0.386 7e-33
Q9LIP6 500 Cytochrome P450 71B34 OS= no no 0.869 0.412 0.318 1e-24
P37119 365 Cytochrome P450 71A3 (Fra N/A no 0.898 0.583 0.310 6e-24
>sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 Back     alignment and function desciption
 Score =  192 bits (488), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/212 (44%), Positives = 141/212 (66%), Gaps = 21/212 (9%)

Query: 41  PEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECF 100
           P  +GAWP +GHLHLL+G  QL++RTLGKMAD+YG A  + LG     V+SS+EVAK+CF
Sbjct: 33  PAPSGAWPIIGHLHLLSGKEQLLYRTLGKMADQYGPAMSLRLGSSETFVVSSFEVAKDCF 92

Query: 101 STNDK-LFSTP----AKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRD 155
           + NDK L S P    AK MGYD A+ GFAPY ++WRE+RK++T +LLSN RL++LKHVR 
Sbjct: 93  TVNDKALASRPITAAAKHMGYDCAVFGFAPYSAFWREMRKIATLELLSNRRLQMLKHVRV 152

Query: 156 TEVKVFIKELHEQCAKNGGH--VAVEMKERFKDLAMNIID--------------TNADDQ 199
           +E+ + +++L+    K GG   V V++K   +D+++N++               +  D +
Sbjct: 153 SEISMVMQDLYSLWVKKGGSEPVMVDLKSWLEDMSLNMMVRMVAGKRYFGGGSLSPEDAE 212

Query: 200 ESKRFQKALRDFLYLLGLFLASDNIPFLGWLD 231
           E+++ +K + +F +L+G+F  SD  P LGW D
Sbjct: 213 EARQCRKGVANFFHLVGIFTVSDAFPKLGWFD 244
Can hydroxylates 8-methoxypsoralen to form 5-hydroxy-8-methoxypsoralen in vivo and in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 Back     alignment and function description
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function description
>sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 Back     alignment and function description
>sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 Back     alignment and function description
>sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 Back     alignment and function description
>sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 Back     alignment and function description
>sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 Back     alignment and function description
>sp|P37119|C71A3_SOLME Cytochrome P450 71A3 (Fragment) OS=Solanum melongena GN=CYP71A3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
255556195320 cytochrome P450, putative [Ricinus commu 0.991 0.734 0.549 9e-77
224123398 525 cytochrome P450 [Populus trichocarpa] gi 0.962 0.434 0.563 8e-76
225428620 527 PREDICTED: cytochrome P450 82C4 [Vitis v 0.995 0.447 0.569 1e-68
147792578 527 hypothetical protein VITISV_016844 [Viti 0.995 0.447 0.533 4e-68
359475243 527 PREDICTED: cytochrome P450 82C4 [Vitis v 0.995 0.447 0.533 1e-67
297741379 607 unnamed protein product [Vitis vinifera] 0.995 0.388 0.533 2e-67
147862807 496 hypothetical protein VITISV_004720 [Viti 0.995 0.475 0.565 2e-67
224085829 487 cytochrome P450 [Populus trichocarpa] gi 0.831 0.404 0.558 1e-65
225428628 516 PREDICTED: cytochrome P450 82C4 [Vitis v 0.983 0.451 0.514 2e-63
359475141 477 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.974 0.484 0.521 3e-63
>gi|255556195|ref|XP_002519132.1| cytochrome P450, putative [Ricinus communis] gi|223541795|gb|EEF43343.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  292 bits (747), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 182/253 (71%), Gaps = 18/253 (7%)

Query: 1   MGFSHHLQEIVAFYAFIFSIICVYVATSIAKRNKKGGRKPPEAAGAWPCVGHLHLLAGSN 60
           M F  +LQ++ + Y F+ + I + +A   A RNKK  + PPE +G+WP +GHLHLL+ SN
Sbjct: 1   MKFFFYLQDL-SLYTFLLATILLSLAIKYANRNKKNIKNPPEPSGSWPFIGHLHLLSDSN 59

Query: 61  QLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFST-----PAKLMG 115
           QL+HRTLG MAD+ G  F I LG+H+A+VIS+WE+AKECF+ NDK+F T       K+MG
Sbjct: 60  QLLHRTLGSMADELGPIFSIRLGVHQAVVISNWELAKECFTINDKVFQTRPESLAVKIMG 119

Query: 116 YDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKN-GG 174
           YD  + GFAPYG YWR+VRKL+T +LLSN RLELLKHVRD E K+F KEL+++  KN GG
Sbjct: 120 YDQVMFGFAPYGKYWRDVRKLATVELLSNRRLELLKHVRDRETKLFFKELYQESVKNGGG 179

Query: 175 HVAVEMKERFKDLAMNII-----------DTNADDQESKRFQKALRDFLYLLGLFLASDN 223
           +  +EMKERF++LAMNII                D+ES+RF KAL DF+ L GL LASD 
Sbjct: 180 NTVIEMKERFEELAMNIIVKMIAGKRFFGGNGIRDEESRRFSKALGDFMQLTGLVLASDT 239

Query: 224 IPFLGWLDTVKGY 236
           +PFLGW+D+++GY
Sbjct: 240 VPFLGWVDSMRGY 252

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224123398|ref|XP_002330305.1| cytochrome P450 [Populus trichocarpa] gi|222871340|gb|EEF08471.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225428620|ref|XP_002284806.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147792578|emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475243|ref|XP_002284810.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741379|emb|CBI32510.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147862807|emb|CAN81092.1| hypothetical protein VITISV_004720 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224085829|ref|XP_002335254.1| cytochrome P450 [Populus trichocarpa] gi|222833155|gb|EEE71632.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225428628|ref|XP_002281361.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475141|ref|XP_003631598.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
TAIR|locus:2116607 524 CYP82C4 ""cytochrome P450, fam 0.742 0.335 0.5 3.5e-43
TAIR|locus:2116652 523 CYP82C2 ""cytochrome P450, fam 0.742 0.336 0.483 1.5e-42
TAIR|locus:2116622 512 CYP82C3 ""cytochrome P450, fam 0.894 0.414 0.365 4.1e-33
TAIR|locus:2090275 515 CYP82G1 "cytochrome P450, fami 0.789 0.363 0.379 2.1e-29
TAIR|locus:2040174 527 CYP82F1 ""cytochrome P450, fam 0.894 0.402 0.340 4.2e-28
TAIR|locus:2058657 543 CYP81D7 ""cytochrome P450, fam 0.915 0.399 0.306 3.6e-23
TAIR|locus:2158222 507 CYP81G1 ""cytochrome P450, fam 0.911 0.426 0.283 1.6e-22
TAIR|locus:2114965 518 CYP81H1 ""cytochrome P450, fam 0.742 0.339 0.328 1.7e-21
TAIR|locus:2079251 500 CYP71B34 ""cytochrome P450, fa 0.898 0.426 0.294 5.4e-21
TAIR|locus:2079311 500 CYP71B36 ""cytochrome P450, fa 0.915 0.434 0.277 1.1e-20
TAIR|locus:2116607 CYP82C4 ""cytochrome P450, family 82, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 456 (165.6 bits), Expect = 3.5e-43, P = 3.5e-43
 Identities = 92/184 (50%), Positives = 130/184 (70%)

Query:    17 IFSIICVYVATSIAKRNKKGGR-KPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYG 75
             +F  I V+V  ++ K++KK    K P  +GAWP +GHLHLL G  QL++RTLGKMAD YG
Sbjct:     8 LFVPILVFVFIALFKKSKKPKYVKAPAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYG 67

Query:    76 RAFLIHLGIHRALVISSWEVAKECFSTNDK-LFSTP----AKLMGYDHAIIGFAPYGSYW 130
              A  + LG + A V+SS+EVAK+CF+ NDK L S P    AK MGY+ A+ GFAPY ++W
Sbjct:    68 PAMSLQLGSNEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFW 127

Query:   131 REVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGH--VAVEMKERFKDLA 188
             RE+RK++T +LLSN RL++LKHVR +E+ + +K+L+    KNGG   V V++K   +D+ 
Sbjct:   128 REMRKIATIELLSNRRLQMLKHVRVSEITMGVKDLYSLWFKNGGTKPVMVDLKSWLEDMT 187

Query:   189 MNII 192
             +N+I
Sbjct:   188 LNMI 191
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IDA
GO:0071281 "cellular response to iron ion" evidence=IEP
GO:0010043 "response to zinc ion" evidence=RCA
TAIR|locus:2116652 CYP82C2 ""cytochrome P450, family 82, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116622 CYP82C3 ""cytochrome P450, family 82, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090275 CYP82G1 "cytochrome P450, family 82, subfamily G, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040174 CYP82F1 ""cytochrome P450, family 82, subfamily F, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058657 CYP81D7 ""cytochrome P450, family 81, subfamily D, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158222 CYP81G1 ""cytochrome P450, family 81, subfamily G, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114965 CYP81H1 ""cytochrome P450, family 81, subfamily H, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079311 CYP71B36 ""cytochrome P450, family 71, subfamily B, polypeptide 36"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-32
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-26
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 6e-24
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-19
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-18
pfam00067 461 pfam00067, p450, Cytochrome P450 6e-15
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 8e-15
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-11
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-09
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 5e-08
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 5e-07
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 2e-06
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 5e-04
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information 
 Score =  121 bits (305), Expect = 5e-32
 Identities = 73/234 (31%), Positives = 117/234 (50%), Gaps = 19/234 (8%)

Query: 7   LQEIVAFYAFIFSIICVYVATSIAKRNKKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRT 66
           LQ ++   +F   +I +++   +  R ++    PP   G  P +G++ ++   +QL HR 
Sbjct: 5   LQSLLTSPSFFLILISLFLFLGLISRLRRRLPYPPGPKG-LPIIGNMLMM---DQLTHRG 60

Query: 67  LGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFST-PAKL----MGYDHAII 121
           L  +A +YG  F + +G    + +SS EVA++     D +FS  PA +    + YD A +
Sbjct: 61  LANLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQVQDSVFSNRPANIAISYLTYDRADM 120

Query: 122 GFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMK 181
            FA YG +WR++RKL   +L S  R E    VRD EV   ++ +    + N G   V + 
Sbjct: 121 AFAHYGPFWRQMRKLCVMKLFSRKRAESWASVRD-EVDSMVRSV----SSNIGK-PVNIG 174

Query: 182 ERFKDLAMNIIDTNA----DDQESKRFQKALRDFLYLLGLFLASDNIPFLGWLD 231
           E    L  NI    A     ++    F K L++F  L G F  +D IP+LGW+D
Sbjct: 175 ELIFTLTRNITYRAAFGSSSNEGQDEFIKILQEFSKLFGAFNVADFIPWLGWID 228

Length = 516
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 237
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02687 517 flavonoid 3'-monooxygenase 99.96
PLN02971 543 tryptophan N-hydroxylase 99.95
PLN02183 516 ferulate 5-hydroxylase 99.95
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.94
PLN03112 514 cytochrome P450 family protein; Provisional 99.94
PLN03234 499 cytochrome P450 83B1; Provisional 99.94
PLN02966 502 cytochrome P450 83A1 99.94
PLN02290 516 cytokinin trans-hydroxylase 99.93
PTZ00404 482 cytochrome P450; Provisional 99.93
PLN02655 466 ent-kaurene oxidase 99.92
PLN00168 519 Cytochrome P450; Provisional 99.92
PLN02394 503 trans-cinnamate 4-monooxygenase 99.92
PLN03018 534 homomethionine N-hydroxylase 99.92
PLN02500 490 cytochrome P450 90B1 99.91
PLN02196 463 abscisic acid 8'-hydroxylase 99.91
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.89
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.88
PLN02774 463 brassinosteroid-6-oxidase 99.88
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.88
PLN02302 490 ent-kaurenoic acid oxidase 99.88
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.84
PLN02738 633 carotene beta-ring hydroxylase 99.84
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.84
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.83
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.82
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.8
PLN02936 489 epsilon-ring hydroxylase 99.8
PLN02648 480 allene oxide synthase 99.79
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.65
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.63
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.88
KOG3653 534 consensus Transforming growth factor beta/activin 80.04
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=3e-31  Score=217.44  Aligned_cols=194  Identities=37%  Similarity=0.621  Sum_probs=166.4

Q ss_pred             CCCCCCCCCCCCCcccccccccccCCChhhHHHHHHHHHhCCeEEEecCCeeEEEecCHHHHHHHHhhCCCcccC-c---
Q 045409           35 KGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFST-P---  110 (237)
Q Consensus        35 ~~~~~~pgp~~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~v~~~~~~~~~~v~i~~p~~~~~i~~~~~~~~~~-~---  110 (237)
                      ++.+.||||+ ++|++||++++ .. ...+..+.+|+++|||++.+++|..++|+++|+++++|++.+++..|.+ .   
T Consensus        23 ~~~~lPPGP~-~lPiIGnl~~l-~~-~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~   99 (489)
T KOG0156|consen   23 KRRNLPPGPP-PLPIIGNLHQL-GS-LPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPT   99 (489)
T ss_pred             CCCCCCcCCC-CCCccccHHHc-CC-CchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCch
Confidence            3478999998 89999999999 41 2599999999999999999999999999999999999999999999988 2   


Q ss_pred             --cccccCCCCeeEeccCCcchHHHHHHHHHhhCCHHHHHHhHHHHHHHHHHHHHHHHHHHhhcCCCceeecHHHHHHHH
Q 045409          111 --AKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLA  188 (237)
Q Consensus       111 --~~~~~~~~~~~~~~~~g~~w~~~R~~l~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~d~~~~~~~~~  188 (237)
                        ...+..++.|++++.||+.|+.+||+....+++...++.......+|++.+++.+.+   ...+ +++|+.+.+..++
T Consensus       100 ~~~~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~---~~~~-~~vdl~~~l~~~~  175 (489)
T KOG0156|consen  100 ATLKYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK---SKKG-EPVDLSELLDLLV  175 (489)
T ss_pred             hhHHHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh---cCCC-ceeeHHHHHHHHH
Confidence              144555667999998899999999999999999999999988889999999999965   1223 7899999999999


Q ss_pred             HHHHhc---C--C---CchHHHHHHHHHHHHHHHhccCCcccccc-ccccccCcCC
Q 045409          189 MNIIDT---N--A---DDQESKRFQKALRDFLYLLGLFLASDNIP-FLGWLDTVKG  235 (237)
Q Consensus       189 ~~vi~~---g--~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~P-~l~~lp~~~~  235 (237)
                      .++|++   |  .   ++++..++.+++.+..+..+.+.+.+++| +++++|..+|
T Consensus       176 ~nvI~~~~fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g  231 (489)
T KOG0156|consen  176 GNVICRMLFGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISG  231 (489)
T ss_pred             HHHHHHHHhCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccH
Confidence            999999   5  2   22455668999999999999988889999 7888874434

>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 8e-06
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-05
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 2e-05
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-05
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-05
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-05
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-05
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-05
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 3e-05
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 3e-05
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 3e-05
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 3e-05
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 3e-05
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 4e-05
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 6e-05
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 7e-04
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure 
Iteration: 1

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 6/111 (5%)
Query: 34  KKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSW 93
           KK G K P++  + P VG L  L     + H    K+  KYG  + + +G    +++   
Sbjct: 3   KKTGAKYPKSLLSLPLVGSLPFLPRHGHM-HNNFFKLQKKYGPIYSVRMGTKTTVIVGHH 61
Query: 94  EVAKECFSTNDKLFSTPAKLMGYDHAI-----IGFAPYGSYWREVRKLSTA 139
           ++AKE      K FS   ++   D A      I FA  G++W+  R+L+ A
Sbjct: 62  QLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMA 112
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 7e-39
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-34
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 7e-31
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-26
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-21
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-21
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-21
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 3e-21
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-18
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-18
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-18
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-15
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-15
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-14
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 4e-14
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 8e-14
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-13
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-12
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-11
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 4e-11
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 9e-10
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-08
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 3e-08
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-07
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 5e-06
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  139 bits (352), Expect = 7e-39
 Identities = 29/218 (13%), Positives = 59/218 (27%), Gaps = 39/218 (17%)

Query: 29  IAKRNKKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRAL 88
           +  R  +   +PP   G  P +GH        +   + L +M +K+G  F +        
Sbjct: 9   LYGRRTRRRNEPPLDKGMIPWLGHALEFG---KDAAKFLTRMKEKHGDIFTVRAAGLYIT 65

Query: 89  VISSWEVAKECFSTNDKLFSTP-AKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSNHRL 147
           V+          S    L  T  A+++      +    +     + R            L
Sbjct: 66  VLLDSNCYDAVLSDVASLDQTSYAQVLMKRIFNMILPSHNPESEKKRAEMH---FQGASL 122

Query: 148 ELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNII--------------D 193
             L +     +++ +             + ++  E  KD   N+                
Sbjct: 123 TQLSNSMQNNLRLLMTP---------SEMGLKTSEWKKDGLFNLCYSLLFKTGYLTVFGA 173

Query: 194 TNADDQESKRFQKALRDFLYLLGLFLASDNIPFLGWLD 231
            N +     +  +  R F            +P L    
Sbjct: 174 ENNNSAALTQIYEEFRRF---------DKLLPKLARTT 202
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.95
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.93
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.93
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.92
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.91
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.91
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.91
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.91
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.91
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.91
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.9
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.9
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.89
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.89
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.88
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.87
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.86
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.86
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.85
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.83
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.83
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.83
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.81
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.78
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.77
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.76
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.75
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.75
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.72
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.71
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.7
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.7
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.7
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.69
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.67
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.66
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.64
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.64
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.64
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.64
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.63
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.61
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.61
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.61
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.6
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.59
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.59
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.59
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.59
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.58
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.58
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.58
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.57
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.57
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.55
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.53
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.53
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.52
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.51
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.51
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.5
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.49
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.47
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.47
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.45
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.44
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.41
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.4
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.37
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.35
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.33
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.31
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.23
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.2
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.13
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.84
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 97.55
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.95  E-value=7.6e-27  Score=194.07  Aligned_cols=189  Identities=21%  Similarity=0.315  Sum_probs=144.4

Q ss_pred             CCCCCCCCCCCCCcccccccccccCCChhhHHHHHHHHHhCCeEEEecCCeeEEEecCHHHHHHHHhhCCCcccC-----
Q 045409           35 KGGRKPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLFST-----  109 (237)
Q Consensus        35 ~~~~~~pgp~~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~v~~~~~~~~~~v~i~~p~~~~~i~~~~~~~~~~-----  109 (237)
                      +..+.||||+ ++|++||++++ ...++.+..+.+|+++||+|+++++|+.++|+++||+++++++.+++..|.+     
T Consensus         5 ~~~~~PPgP~-~lPliGnl~~l-~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~   82 (494)
T 3swz_A            5 TGAKYPKSLL-SLPLVGSLPFL-PRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMA   82 (494)
T ss_dssp             -------CCB-CCCEEEEESSC-TTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCH
T ss_pred             CCCCCCCCCC-CCCeEcchHHh-CCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcH
Confidence            3456899998 79999999988 4335688999999999999999999999999999999999999988888876     


Q ss_pred             ccccccCCCCeeEeccCCcchHHHHHHHHHhhCCH--HHHHHhHHHHHHHHHHHHHHHHHHHhhcCCCceeecHHHHHHH
Q 045409          110 PAKLMGYDHAIIGFAPYGSYWREVRKLSTAQLLSN--HRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDL  187 (237)
Q Consensus       110 ~~~~~~~~~~~~~~~~~g~~w~~~R~~l~~~~~~~--~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~d~~~~~~~~  187 (237)
                      ..+.++..+.|++++++|+.|+.+||++.++| +.  ..+..+.+.+.++++.+++.+.+     .+++++|+...+.++
T Consensus        83 ~~~~~~~~~~gl~~~~~g~~wr~~Rr~~~~~f-~~~~~~~~~~~~~i~~~~~~l~~~l~~-----~~~~~vd~~~~~~~~  156 (494)
T 3swz_A           83 TLDIASNNRKGIAFADSGAHWQLHRRLAMATF-ALFKDGDQKLEKIICQEISTLCDMLAT-----HNGQSIDISFPVFVA  156 (494)
T ss_dssp             HHHHHTTTTCSSSSSCSSHHHHHHHHHHHHHT-TTTSSSTTCHHHHHHHHHHHHHHHHHH-----TTTEEECCHHHHHHH
T ss_pred             HHHHhccCCCCeEeCCCCHHHHHHHHHHHHHH-HHhcchHHHHHHHHHHHHHHHHHHHHH-----cCCCcccHHHHHHHH
Confidence            22334444557778877999999999999876 52  44667889999999999998854     346789999999999


Q ss_pred             HHHHHhc---CC----CchHHHHHHHHHHHHHHHhccCCcccccccccccc
Q 045409          188 AMNIIDT---NA----DDQESKRFQKALRDFLYLLGLFLASDNIPFLGWLD  231 (237)
Q Consensus       188 ~~~vi~~---g~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~lp  231 (237)
                      ++|+|+.   |.    +++....+.+..+.+........+.+.+||++++|
T Consensus       157 t~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~p  207 (494)
T 3swz_A          157 VTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFP  207 (494)
T ss_dssp             HHHHHHHHHHSCCCCTTCTHHHHHHHHHHHHHHHHCSSSSCCSSCGGGTSC
T ss_pred             HHHHHHHHHcCCcCCCCCHHHHHHHHHHHHHHHhcccchHHHHHHHHHHcC
Confidence            9999999   42    22333444444445555555555677899999988
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 237
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-20
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-19
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-19
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-15
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-13
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-12
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-10
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 7e-08
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 0.002
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 86.3 bits (212), Expect = 3e-20
 Identities = 35/198 (17%), Positives = 74/198 (37%), Gaps = 19/198 (9%)

Query: 46  AWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDK 105
             P +G+++ LA S++L H  + K +  YG  F + LG    +V++ ++V KEC     +
Sbjct: 6   GLPFIGNIYSLAASSELPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSE 65

Query: 106 LFSTPAKLMGYDHAIIG----FAPYGSYWREVRKLSTAQLL-SNHRLELLKHVRDTEVKV 160
           +F+    L  +           + YG  W + R+L+        +  +  +     E K 
Sbjct: 66  IFADRPCLPLFMKMTKMGGLLNSRYGRGWVDHRRLAVNSFRYFGYGQKSFESKILEETKF 125

Query: 161 FIKELHEQCAKNGGHVAVEMKERFKDLAMNII-------DTNADDQESKRFQKALRDFLY 213
           F   +     +       + K+   +   NI            +D + +   +   + + 
Sbjct: 126 FNDAIETYKGR-----PFDFKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVE 180

Query: 214 LL--GLFLASDNIPFLGW 229
           L         +  P++G 
Sbjct: 181 LAASASVFLYNAFPWIGI 198
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.9
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.9
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.87
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.84
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.84
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.82
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.75
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.75
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.58
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.44
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.42
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.36
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.31
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.29
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.1
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.05
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.04
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.02
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.85
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.74
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.06
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=8.9e-24  Score=172.25  Aligned_cols=147  Identities=17%  Similarity=0.287  Sum_probs=124.8

Q ss_pred             CCCCCCCCCcccccccccccCCChhhHHHHHHHHHhCCeEEEecCCeeEEEecCHHHHHHHHhhCCCcc-cC--cccccc
Q 045409           39 KPPEAAGAWPCVGHLHLLAGSNQLIHRTLGKMADKYGRAFLIHLGIHRALVISSWEVAKECFSTNDKLF-ST--PAKLMG  115 (237)
Q Consensus        39 ~~pgp~~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~v~~~~~~~~~~v~i~~p~~~~~i~~~~~~~~-~~--~~~~~~  115 (237)
                      .+|||+ ++|++||++++ .  ++++.++.++++||||||++++++.++|+++||+++++++.++...+ ..  ......
T Consensus        10 ~iPGP~-~~P~iG~~~~~-~--~~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~~   85 (472)
T d1tqna_          10 GIPGPT-PLPFLGNILSY-H--KGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVG   85 (472)
T ss_dssp             TCCCCC-CBTTTBTGGGG-G--GCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCCG
T ss_pred             CCCCCC-CcCceeEHHHh-h--CCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCccccccc
Confidence            679998 79999999998 6  78999999999999999999999999999999999999998765433 32  222222


Q ss_pred             CCCCeeEeccCCcchHHHHHHHHHhhCCHHHHHHhHHHHHHHHHHHHHHHHHHHhhcCCCceeecHHHHHHHHHHHHhc
Q 045409          116 YDHAIIGFAPYGSYWREVRKLSTAQLLSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIDT  194 (237)
Q Consensus       116 ~~~~~~~~~~~g~~w~~~R~~l~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~d~~~~~~~~~~~vi~~  194 (237)
                      ..+.++++++ |+.|+.+|++++++| +.+.++.+.+.++++++.+++.|.+..   .++..+|+.+.+.++++|+++.
T Consensus        86 ~~~~~i~~~~-g~~~~~~R~~~~~~~-~~~~l~~~~~~~~~~~~~~~~~l~~~~---~~~~~~dl~~~~~~~~~~v~~~  159 (472)
T d1tqna_          86 FMKSAISIAE-DEEWKRLRSLLSPTF-TSGKLKEMVPIIAQYGDVLVRNLRREA---ETGKPVTLKDVFGAYSMDVITS  159 (472)
T ss_dssp             GGGGSTTTCC-HHHHHHHHHHTTGGG-SHHHHHTTHHHHHHHHHHHHHHHHHHH---HHSSCEEHHHHHHHHHHHHHHH
T ss_pred             ccCCceeccC-cHHHHHhhhhcCccc-cchhhhcccchhhhhhhcccccccccc---cccccchhhhhhhccchhhhhh
Confidence            2334666665 999999999999876 999999999999999999999998763   3456899999999999999999
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure