Citrus Sinensis ID: 045443

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----

MGYHYSCNGLLLLVSVLMVVASSAVGSFYQDFDLTWGDKRAKIFNGGQLLSLSLDRVSGSGFQSKRDYLFGRIDMQLKLVAGDSAGTVTAYYLSSQGPTHDEIDFEFLGNVSGQPYILHTNIFAQGKGNREQQFYLWFDPTRNFHTYSVIWKPQHITFPLECSKMLNLLEFPSLKNQPMKIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFRAIPCNNCGSKRSSSSSVSDAQRQWQPRDELDATSRRRLRWVQKYFMIYNYCTDLKRFPQGFLLSADNTS

cccccHHHHHHHHHHHHHHHccccccccccccccEEccccEEEEcccCEEEEEEccccccCEECccCEEEEEEEEEEEEEcccccEEEEEEEECccccccccccEEECcccccccEEEEEEEEEcccccCEEEEEcccccccccCEEEEEECccEEEEEEccCEEEEEccccccccccCEEEEEEcccccccccccCEECccccccEEEEEEEEEEECccccccccccccccccccccccccccccHHHHHHHHHHHHccEEEccccccccccccccccccccc

**YHYSCNGLLLLVSVLMVVASSAVGSFYQDFDLTWGDKRAKIFNGGQLLSLSLDRVSGSGFQSKRDYLFGRIDMQLKLVAGDSAGTVTAYYLSSQGPTHDEIDFEFLGNVSGQPYILHTNIFAQGKGNREQQFYLWFDPTRNFHTYSVIWKPQHITFPLECSKMLNLLEFPSLKNQPMKIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFRAIPCNNCG*************RQWQ**DEL*ATSRRRLRWVQKYFMIYNYCTDLKRFPQGFLLSAD***

xxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Brassinosteroid-regulated protein BRU1	Possible role in brassinosteroid-stimulated elongation.	confident	P35694
Probable xyloglucan endotransglucosylase/hydrolase protein 16	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.	probable	Q8LG58
Probable xyloglucan endotransglucosylase/hydrolase protein	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.	probable	P93349

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMZ, chain A
Confidence level:very confident
Coverage over the Query: 23-282
View the alignment between query and template
View the model in PyMOL