Citrus Sinensis ID: 045471

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MKAGAVEIGEAKNSTPTYGVNKGISILDFVLRLLAFAGALGSAIAMGTTNETLPFFSQLIRFRAEYDDLPSFTFFVAANAVVSGYLILSLSLSIFHIVRSRAQKSRILLVFFDTAMLALLTGSASAAAAIVYLAHKGNAKANWFAICQQFNSFCQRISGSLIGSFVGMALLILIIMLCGVALSRR
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEECcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
******************GVNKGISILDFVLRLLAFAGALGSAIAMGTTNETLPFFSQLIRFRAEYDDLPSFTFFVAANAVVSGYLILSLSLSIFHIVRSRAQKSRILLVFFDTAMLALLTGSASAAAAIVYLAHKGNAKANWFAICQQFNSFCQRISGSLIGSFVGMALLILIIMLCGVALSR*
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAGAVEIGEAKNSTPTYGVNKGISILDFVLRLLAFAGALGSAIAMGTTNETLPFFSQLIRFRAEYDDLPSFTFFVAANAVVSGYLILSLSLSIFHIVRSRAQKSRILLVFFDTAMLALLTGSASAAAAIVYLAHKGNAKANWFAICQQFNSFCQRISGSLIGSFVGMALLILIIMLCGVALSRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Casparian strip membrane protein VIT_14s0108g01050 Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.confidentA7PMY7
Casparian strip membrane protein POPTRDRAFT_569472 Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.confidentB9I534
CASP-like protein Bradi1g45110 probableP0DI36

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted