Citrus Sinensis ID: 045474

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-

MDTFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYEKVVRDTCRGIGFVSADVGLDADKCKVLVNIEEQSPEIAQSVHGNLSKRPEEIGAGDQGHMFGYATDETPELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAACGHFGRDDPDFTWETVKLLKPTEA

cccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEccccEEEEEEEEcccEEEcHHHHHHHHccccccccccccccccccEEEEEcccccHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccccccEEEEEEEEcccccccccHHHHHHHHHHccccccccccccccccEEEEcccccEEEccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHccccHHHHHHHcccccccccHHHHccccccccccccccccccccccccccc

*********SVNEGHPDKLCDQISDAILDACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYEKVVRDTCRGIGFVSADVGLDADKCKVLVNIEEQSPEIAQSVHGNLSKRPEEIGAGDQGHMFGYATDETPELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAACGHFGRDDPDFTWETVKLLKPTEA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
S-adenosylmethionine synthase 4	Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.	confident	A9PHC5
S-adenosylmethionine synthase 1	Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.	confident	A7PQS0
S-adenosylmethionine synthase 3	Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.	confident	A7QJG1

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.5.-.-	Transferring alkyl or aryl groups, other than methyl groups.	probable
2.5.1.-	5,10-methenyltetrahydromethanopterin hydrogenase.	probable
2.5.1.6	Transferred entry: 2.5.1.6.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P02, chain A
Confidence level:very confident
Coverage over the Query: 3-388
View the alignment between query and template
View the model in PyMOL