Citrus Sinensis ID: 045545


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MNTTRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAGAKEVHMRIASPPIIASCYYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKMLGDDSQNFCYACFSGKYPVKPEEMKVKRVGEFVDDG
ccccccccccccccccHHHHHHcccccccccccccccCEEEEcccccccccHHHHHHHHHHccccCEEEEEccccccccccccccccccHHHHcccccHHHHHHHHcccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHccccccc
MNTTRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAGAKEVHMRIASPPIIASCYYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKMLGDDSQNFCYACFSGKYPVKPEEMKVKRVGEFV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTTRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAGAKEVHMRIASPPIIASCYYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKMLGDDSQNFCYACFSGKYPVKPEEMKVKRVGEFVDDG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Amidophosphoribosyltransferase 2, chloroplastic Catalyzes the first committed step of 'de novo purine biosynthesis from glutamine. Required for chloroplast biogenesis and cell division. Confers sensitivity to the phenyltriazole acetic acid compound [5-(4-chlorophenyl)-1-isopropyl-1H-[1,2,4]triazol-3-yl]-acetic acid (DAS734), a bleaching herbicide.probableQ9STG9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AO0, chain A
Confidence level:very confident
Coverage over the Query: 2-145
View the alignment between query and template
View the model in PyMOL