Citrus Sinensis ID: 045545
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 158 | ||||||
| 255543899 | 593 | amidophosphoribosyltransferase, putative | 0.981 | 0.261 | 0.877 | 2e-74 | |
| 224080500 | 586 | predicted protein [Populus trichocarpa] | 0.981 | 0.264 | 0.877 | 1e-73 | |
| 357473601 | 569 | Amidophosphoribosyltransferase [Medicago | 0.981 | 0.272 | 0.870 | 2e-72 | |
| 118485692 | 585 | unknown [Populus trichocarpa] | 0.981 | 0.264 | 0.858 | 5e-72 | |
| 224103309 | 485 | predicted protein [Populus trichocarpa] | 0.981 | 0.319 | 0.858 | 2e-71 | |
| 449464834 | 577 | PREDICTED: amidophosphoribosyltransferas | 0.981 | 0.268 | 0.864 | 3e-71 | |
| 449528403 | 623 | PREDICTED: amidophosphoribosyltransferas | 0.981 | 0.248 | 0.864 | 3e-71 | |
| 388495666 | 261 | unknown [Lotus japonicus] | 0.981 | 0.593 | 0.864 | 5e-71 | |
| 356545023 | 566 | PREDICTED: amidophosphoribosyltransferas | 0.981 | 0.273 | 0.851 | 7e-71 | |
| 356531589 | 573 | PREDICTED: amidophosphoribosyltransferas | 0.981 | 0.270 | 0.851 | 1e-70 |
| >gi|255543899|ref|XP_002513012.1| amidophosphoribosyltransferase, putative [Ricinus communis] gi|223548023|gb|EEF49515.1| amidophosphoribosyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 283 bits (723), Expect = 2e-74, Method: Compositional matrix adjust.
Identities = 136/155 (87%), Positives = 146/155 (94%)
Query: 4 TRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAG 63
+ Y TFIEPSQKIRDFGVKLKLSPV GVLEG+RVVVVDDSIVRGTTSSKIVRLLKEAG
Sbjct: 405 SHYVGRTFIEPSQKIRDFGVKLKLSPVRGVLEGQRVVVVDDSIVRGTTSSKIVRLLKEAG 464
Query: 64 AKEVHMRIASPPIIASCYYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKML 123
AKEVHMRIASPPIIASCYYGVDTPSSEELISNRM+VEEIREFIGCDSLAFL +DSL +L
Sbjct: 465 AKEVHMRIASPPIIASCYYGVDTPSSEELISNRMTVEEIREFIGCDSLAFLPLDSLKNLL 524
Query: 124 GDDSQNFCYACFSGKYPVKPEEMKVKRVGEFVDDG 158
G+DS NFCYACFSGKYPV+P+E+KVKRVG+FVDDG
Sbjct: 525 GNDSSNFCYACFSGKYPVEPKELKVKRVGDFVDDG 559
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224080500|ref|XP_002306145.1| predicted protein [Populus trichocarpa] gi|222849109|gb|EEE86656.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357473601|ref|XP_003607085.1| Amidophosphoribosyltransferase [Medicago truncatula] gi|355508140|gb|AES89282.1| Amidophosphoribosyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|118485692|gb|ABK94696.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224103309|ref|XP_002313004.1| predicted protein [Populus trichocarpa] gi|222849412|gb|EEE86959.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449464834|ref|XP_004150134.1| PREDICTED: amidophosphoribosyltransferase 2, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449528403|ref|XP_004171194.1| PREDICTED: amidophosphoribosyltransferase 2, chloroplastic-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388495666|gb|AFK35899.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356545023|ref|XP_003540945.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531589|ref|XP_003534359.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 158 | ||||||
| TAIR|locus:2139549 | 561 | ASE2 "GLN phosphoribosyl pyrop | 0.981 | 0.276 | 0.825 | 5.2e-65 | |
| TAIR|locus:2045081 | 566 | ASE1 "GLN phosphoribosyl pyrop | 0.981 | 0.273 | 0.826 | 4.7e-64 | |
| TAIR|locus:2141811 | 532 | ASE3 "GLN phosphoribosyl pyrop | 0.898 | 0.266 | 0.706 | 2e-49 | |
| TIGR_CMR|GSU_1636 | 466 | GSU_1636 "amidophosphoribosylt | 0.860 | 0.291 | 0.595 | 1.1e-39 | |
| TIGR_CMR|DET_1415 | 472 | DET_1415 "amidophosphoribosylt | 0.886 | 0.296 | 0.556 | 2.1e-38 | |
| TIGR_CMR|BA_0295 | 471 | BA_0295 "amidophosphoribosyltr | 0.860 | 0.288 | 0.564 | 1.7e-36 | |
| TIGR_CMR|CHY_1075 | 452 | CHY_1075 "amidophosphoribosylt | 0.848 | 0.296 | 0.536 | 2.7e-36 | |
| TIGR_CMR|SPO_2677 | 490 | SPO_2677 "amidophosphoribosylt | 0.898 | 0.289 | 0.5 | 3.1e-35 | |
| TIGR_CMR|APH_1300 | 468 | APH_1300 "amidophosphoribosylt | 0.867 | 0.292 | 0.478 | 2.5e-33 | |
| TIGR_CMR|ECH_0139 | 462 | ECH_0139 "amidophosphoribosylt | 0.860 | 0.294 | 0.482 | 8.5e-33 |
| TAIR|locus:2139549 ASE2 "GLN phosphoribosyl pyrophosphate amidotransferase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 662 (238.1 bits), Expect = 5.2e-65, P = 5.2e-65
Identities = 128/155 (82%), Positives = 141/155 (90%)
Query: 4 TRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAG 63
+ Y TFIEPSQKIRDFGVKLKLSPV GVLEGKRVVVVDDSIVRGTTSSKIVRLL+EAG
Sbjct: 393 SHYVGRTFIEPSQKIRDFGVKLKLSPVRGVLEGKRVVVVDDSIVRGTTSSKIVRLLREAG 452
Query: 64 AKEVHMRIASPPIIASCYYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKML 123
AKEVHMRIASPPIIASCYYGVDTPSS ELISNRMSV+EIR++IGCDSLAFL ++L K L
Sbjct: 453 AKEVHMRIASPPIIASCYYGVDTPSSNELISNRMSVDEIRDYIGCDSLAFLSFETLKKHL 512
Query: 124 GDDSQNFCYACFSGKYPVKPEEMKVKRVGEFVDDG 158
G+DS++FCYACF+G YPVKP E KVKR G+F+DDG
Sbjct: 513 GEDSRSFCYACFTGDYPVKPTEDKVKRGGDFIDDG 547
|
|
| TAIR|locus:2045081 ASE1 "GLN phosphoribosyl pyrophosphate amidotransferase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141811 ASE3 "GLN phosphoribosyl pyrophosphate amidotransferase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1636 GSU_1636 "amidophosphoribosyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1415 DET_1415 "amidophosphoribosyltransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_0295 BA_0295 "amidophosphoribosyltransferase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1075 CHY_1075 "amidophosphoribosyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2677 SPO_2677 "amidophosphoribosyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|APH_1300 APH_1300 "amidophosphoribosyltransferase" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0139 ECH_0139 "amidophosphoribosyltransferase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.IV.836.1 | amidophosphoribosyltransferase (EC-2.4.2.14) (485 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.86.80.1 | • | • | • | • | • | 0.997 | |||||
| estExt_fgenesh4_pm.C_LG_X0439 | • | • | • | • | • | 0.970 | |||||
| gw1.X.4384.1 | • | • | • | • | 0.961 | ||||||
| gw1.II.2846.1 | • | • | • | • | • | 0.958 | |||||
| fgenesh4_pm.C_LG_XIV000303 | • | • | • | • | • | 0.954 | |||||
| GART | • | • | • | 0.952 | |||||||
| fgenesh4_pg.C_scaffold_29000089 | • | • | • | • | 0.940 | ||||||
| eugene3.00030549 | • | • | • | • | 0.934 | ||||||
| gw1.XIX.1506.1 | • | • | • | • | • | 0.932 | |||||
| gw1.29.190.1 | • | • | • | 0.932 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| PLN02440 | 479 | PLN02440, PLN02440, amidophosphoribosyltransferase | 5e-92 | |
| COG0034 | 470 | COG0034, PurF, Glutamine phosphoribosylpyrophospha | 8e-76 | |
| PRK09123 | 479 | PRK09123, PRK09123, amidophosphoribosyltransferase | 5e-74 | |
| TIGR01134 | 442 | TIGR01134, purF, amidophosphoribosyltransferase | 8e-72 | |
| PRK08525 | 445 | PRK08525, PRK08525, amidophosphoribosyltransferase | 7e-70 | |
| PRK07349 | 500 | PRK07349, PRK07349, amidophosphoribosyltransferase | 2e-63 | |
| PRK05793 | 469 | PRK05793, PRK05793, amidophosphoribosyltransferase | 3e-63 | |
| PRK07631 | 475 | PRK07631, PRK07631, amidophosphoribosyltransferase | 3e-61 | |
| PRK07272 | 484 | PRK07272, PRK07272, amidophosphoribosyltransferase | 4e-59 | |
| PRK07847 | 510 | PRK07847, PRK07847, amidophosphoribosyltransferase | 3e-57 | |
| PRK06781 | 471 | PRK06781, PRK06781, amidophosphoribosyltransferase | 2e-50 | |
| PRK08341 | 442 | PRK08341, PRK08341, amidophosphoribosyltransferase | 6e-50 | |
| PRK06388 | 474 | PRK06388, PRK06388, amidophosphoribosyltransferase | 3e-46 | |
| PRK09246 | 501 | PRK09246, PRK09246, amidophosphoribosyltransferase | 2e-38 | |
| cd06223 | 130 | cd06223, PRTases_typeI, Phosphoribosyl transferase | 4e-11 | |
| pfam00156 | 123 | pfam00156, Pribosyltran, Phosphoribosyl transferas | 2e-09 | |
| COG0462 | 314 | COG0462, PrsA, Phosphoribosylpyrophosphate synthet | 3e-08 | |
| TIGR01251 | 308 | TIGR01251, ribP_PPkin, ribose-phosphate pyrophosph | 4e-08 | |
| PRK03092 | 304 | PRK03092, PRK03092, ribose-phosphate pyrophosphoki | 2e-06 | |
| PRK00934 | 285 | PRK00934, PRK00934, ribose-phosphate pyrophosphoki | 9e-06 | |
| PLN02369 | 302 | PLN02369, PLN02369, ribose-phosphate pyrophosphoki | 2e-05 | |
| COG0634 | 178 | COG0634, Hpt, Hypoxanthine-guanine phosphoribosylt | 1e-04 | |
| PRK02277 | 200 | PRK02277, PRK02277, orotate phosphoribosyltransfer | 1e-04 | |
| PRK00455 | 202 | PRK00455, pyrE, orotate phosphoribosyltransferase; | 2e-04 | |
| PRK06031 | 233 | PRK06031, PRK06031, phosphoribosyltransferase; Pro | 2e-04 | |
| PRK09162 | 181 | PRK09162, PRK09162, hypoxanthine-guanine phosphori | 5e-04 | |
| COG0856 | 203 | COG0856, COG0856, Orotate phosphoribosyltransferas | 5e-04 | |
| COG0461 | 201 | COG0461, PyrE, Orotate phosphoribosyltransferase [ | 9e-04 | |
| COG1040 | 225 | COG1040, ComFC, Predicted amidophosphoribosyltrans | 0.001 | |
| PRK02812 | 330 | PRK02812, PRK02812, ribose-phosphate pyrophosphoki | 0.001 | |
| TIGR00336 | 173 | TIGR00336, pyrE, orotate phosphoribosyltransferase | 0.002 | |
| TIGR00201 | 190 | TIGR00201, comF, comF family protein | 0.003 | |
| PRK01259 | 309 | PRK01259, PRK01259, ribose-phosphate pyrophosphoki | 0.004 | |
| COG0503 | 179 | COG0503, Apt, Adenine/guanine phosphoribosyltransf | 0.004 |
| >gnl|CDD|215241 PLN02440, PLN02440, amidophosphoribosyltransferase | Back alignment and domain information |
|---|
Score = 275 bits (704), Expect = 5e-92
Identities = 122/154 (79%), Positives = 131/154 (85%), Gaps = 5/154 (3%)
Query: 5 RYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAGA 64
Y TFIEPSQKIRDF VKLKL+PV VLEGKRVVVVDDSIVRGTTSSKIVR+L+EAGA
Sbjct: 309 HYVGRTFIEPSQKIRDFSVKLKLNPVRSVLEGKRVVVVDDSIVRGTTSSKIVRMLREAGA 368
Query: 65 KEVHMRIASPPIIASCYYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKMLG 124
KEVHMRIASPPIIASCYYGVDTPS EELISNRMSVEEIR+FIGCDSLAFL ++ L K LG
Sbjct: 369 KEVHMRIASPPIIASCYYGVDTPSREELISNRMSVEEIRKFIGCDSLAFLPLEDLKKSLG 428
Query: 125 DDSQNFCYACFSGKYPVKPEEMKVKRVGEFVDDG 158
++S FCYACFSG YPV P KRVG +DDG
Sbjct: 429 EESPRFCYACFSGDYPVLP-----KRVGGDIDDG 457
|
Length = 479 |
| >gnl|CDD|223112 COG0034, PurF, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236384 PRK09123, PRK09123, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233285 TIGR01134, purF, amidophosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|181456 PRK08525, PRK08525, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235998 PRK07349, PRK07349, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235611 PRK05793, PRK05793, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181061 PRK07631, PRK07631, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235984 PRK07272, PRK07272, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236113 PRK07847, PRK07847, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|136048 PRK06781, PRK06781, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181395 PRK08341, PRK08341, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|102351 PRK06388, PRK06388, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236427 PRK09246, PRK09246, amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain | Back alignment and domain information |
|---|
| >gnl|CDD|215757 pfam00156, Pribosyltran, Phosphoribosyl transferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|223538 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130318 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >gnl|CDD|179535 PRK03092, PRK03092, ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234868 PRK00934, PRK00934, ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215209 PLN02369, PLN02369, ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >gnl|CDD|223707 COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235023 PRK02277, PRK02277, orotate phosphoribosyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234771 PRK00455, pyrE, orotate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235678 PRK06031, PRK06031, phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181675 PRK09162, PRK09162, hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223925 COG0856, COG0856, Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223537 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223970 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235072 PRK02812, PRK02812, ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129436 TIGR00336, pyrE, orotate phosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|232871 TIGR00201, comF, comF family protein | Back alignment and domain information |
|---|
| >gnl|CDD|234929 PRK01259, PRK01259, ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223577 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| COG0034 | 470 | PurF Glutamine phosphoribosylpyrophosphate amidotr | 100.0 | |
| PRK06388 | 474 | amidophosphoribosyltransferase; Provisional | 100.0 | |
| PRK06781 | 471 | amidophosphoribosyltransferase; Provisional | 100.0 | |
| PRK07631 | 475 | amidophosphoribosyltransferase; Provisional | 100.0 | |
| PRK07349 | 500 | amidophosphoribosyltransferase; Provisional | 100.0 | |
| KOG0572 | 474 | consensus Glutamine phosphoribosylpyrophosphate am | 100.0 | |
| PRK07847 | 510 | amidophosphoribosyltransferase; Provisional | 100.0 | |
| PRK09246 | 501 | amidophosphoribosyltransferase; Provisional | 100.0 | |
| PRK08341 | 442 | amidophosphoribosyltransferase; Provisional | 99.98 | |
| PRK07272 | 484 | amidophosphoribosyltransferase; Provisional | 99.98 | |
| PLN02440 | 479 | amidophosphoribosyltransferase | 99.97 | |
| PRK05793 | 469 | amidophosphoribosyltransferase; Provisional | 99.97 | |
| TIGR01134 | 442 | purF amidophosphoribosyltransferase. Alternate nam | 99.97 | |
| PRK09123 | 479 | amidophosphoribosyltransferase; Provisional | 99.97 | |
| PRK08525 | 445 | amidophosphoribosyltransferase; Provisional | 99.96 | |
| COG0462 | 314 | PrsA Phosphoribosylpyrophosphate synthetase [Nucle | 99.74 | |
| PF14572 | 184 | Pribosyl_synth: Phosphoribosyl synthetase-associat | 99.73 | |
| PRK04923 | 319 | ribose-phosphate pyrophosphokinase; Provisional | 99.7 | |
| PRK02269 | 320 | ribose-phosphate pyrophosphokinase; Provisional | 99.67 | |
| PTZ00145 | 439 | phosphoribosylpyrophosphate synthetase; Provisiona | 99.67 | |
| PRK07199 | 301 | phosphoribosylpyrophosphate synthetase; Provisiona | 99.64 | |
| PRK00553 | 332 | ribose-phosphate pyrophosphokinase; Provisional | 99.64 | |
| PLN02297 | 326 | ribose-phosphate pyrophosphokinase | 99.6 | |
| PRK02458 | 323 | ribose-phosphate pyrophosphokinase; Provisional | 99.6 | |
| PRK03092 | 304 | ribose-phosphate pyrophosphokinase; Provisional | 99.57 | |
| PRK00934 | 285 | ribose-phosphate pyrophosphokinase; Provisional | 99.56 | |
| PRK06827 | 382 | phosphoribosylpyrophosphate synthetase; Provisiona | 99.52 | |
| PRK01259 | 309 | ribose-phosphate pyrophosphokinase; Provisional | 99.51 | |
| KOG1448 | 316 | consensus Ribose-phosphate pyrophosphokinase [Nucl | 99.5 | |
| PRK02812 | 330 | ribose-phosphate pyrophosphokinase; Provisional | 99.49 | |
| PLN02369 | 302 | ribose-phosphate pyrophosphokinase | 99.49 | |
| TIGR01251 | 308 | ribP_PPkin ribose-phosphate pyrophosphokinase. In | 99.39 | |
| PRK09162 | 181 | hypoxanthine-guanine phosphoribosyltransferase; Pr | 99.24 | |
| TIGR00201 | 190 | comF comF family protein. This protein is found in | 99.24 | |
| PRK11595 | 227 | DNA utilization protein GntX; Provisional | 99.09 | |
| TIGR01203 | 166 | HGPRTase hypoxanthine phosphoribosyltransferase. S | 99.09 | |
| PRK05205 | 176 | bifunctional pyrimidine regulatory protein PyrR ur | 99.06 | |
| KOG1503 | 354 | consensus Phosphoribosylpyrophosphate synthetase-a | 99.05 | |
| PF00156 | 125 | Pribosyltran: Phosphoribosyl transferase domain; I | 98.96 | |
| COG0634 | 178 | Hpt Hypoxanthine-guanine phosphoribosyltransferase | 98.95 | |
| PLN02238 | 189 | hypoxanthine phosphoribosyltransferase | 98.94 | |
| COG1040 | 225 | ComFC Predicted amidophosphoribosyltransferases [G | 98.93 | |
| PRK15423 | 178 | hypoxanthine phosphoribosyltransferase; Provisiona | 98.91 | |
| PTZ00149 | 241 | hypoxanthine phosphoribosyltransferase; Provisiona | 98.85 | |
| COG0461 | 201 | PyrE Orotate phosphoribosyltransferase [Nucleotide | 98.85 | |
| PRK13812 | 176 | orotate phosphoribosyltransferase; Provisional | 98.84 | |
| PTZ00271 | 211 | hypoxanthine-guanine phosphoribosyltransferase; Pr | 98.81 | |
| PRK13811 | 170 | orotate phosphoribosyltransferase; Provisional | 98.79 | |
| PRK13809 | 206 | orotate phosphoribosyltransferase; Provisional | 98.76 | |
| TIGR01367 | 187 | pyrE_Therm orotate phosphoribosyltransferase, Ther | 98.75 | |
| TIGR01090 | 169 | apt adenine phosphoribosyltransferase. A phylogene | 98.71 | |
| PRK07322 | 178 | adenine phosphoribosyltransferase; Provisional | 98.71 | |
| PRK02277 | 200 | orotate phosphoribosyltransferase-like protein; Pr | 98.71 | |
| PRK00455 | 202 | pyrE orotate phosphoribosyltransferase; Validated | 98.7 | |
| PLN02293 | 187 | adenine phosphoribosyltransferase | 98.67 | |
| PRK06031 | 233 | phosphoribosyltransferase; Provisional | 98.67 | |
| PRK02304 | 175 | adenine phosphoribosyltransferase; Provisional | 98.66 | |
| COG0856 | 203 | Orotate phosphoribosyltransferase homologs [Nucleo | 98.59 | |
| PRK00129 | 209 | upp uracil phosphoribosyltransferase; Reviewed | 98.58 | |
| TIGR01091 | 207 | upp uracil phosphoribosyltransferase. that include | 98.54 | |
| TIGR00336 | 173 | pyrE orotate phosphoribosyltransferase. The conser | 98.51 | |
| PRK12560 | 187 | adenine phosphoribosyltransferase; Provisional | 98.5 | |
| KOG3367 | 216 | consensus Hypoxanthine-guanine phosphoribosyltrans | 98.45 | |
| PRK13810 | 187 | orotate phosphoribosyltransferase; Provisional | 98.42 | |
| TIGR01744 | 191 | XPRTase xanthine phosphoribosyltransferase. This m | 98.41 | |
| PRK09219 | 189 | xanthine phosphoribosyltransferase; Validated | 98.38 | |
| PRK05500 | 477 | bifunctional orotidine 5'-phosphate decarboxylase/ | 98.33 | |
| PRK08558 | 238 | adenine phosphoribosyltransferase; Provisional | 98.29 | |
| COG0503 | 179 | Apt Adenine/guanine phosphoribosyltransferases and | 98.16 | |
| COG1926 | 220 | Predicted phosphoribosyltransferases [General func | 98.13 | |
| TIGR01743 | 268 | purR_Bsub pur operon repressor, Bacillus subtilis | 98.12 | |
| PRK09213 | 271 | pur operon repressor; Provisional | 98.09 | |
| PRK09177 | 156 | xanthine-guanine phosphoribosyltransferase; Valida | 98.08 | |
| COG2065 | 179 | PyrR Pyrimidine operon attenuation protein/uracil | 98.06 | |
| COG2236 | 192 | Predicted phosphoribosyltransferases [General func | 98.04 | |
| KOG1712 | 183 | consensus Adenine phosphoribosyl transferases [Nuc | 97.91 | |
| PLN02541 | 244 | uracil phosphoribosyltransferase | 97.45 | |
| COG0035 | 210 | Upp Uracil phosphoribosyltransferase [Nucleotide t | 96.97 | |
| PF14681 | 207 | UPRTase: Uracil phosphoribosyltransferase; PDB: 1V | 96.83 | |
| PF15609 | 191 | PRTase_2: Phosphoribosyl transferase | 96.29 | |
| PF15610 | 274 | PRTase_3: PRTase ComF-like | 91.68 | |
| KOG1017 | 267 | consensus Predicted uracil phosphoribosyltransfera | 90.54 |
| >COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.5e-37 Score=267.63 Aligned_cols=145 Identities=57% Similarity=0.992 Sum_probs=140.0
Q ss_pred CCCCccccceeeCCChhhhcccCceeeccccccCCCCEEEEEeccccccHHHHHHHHHHHHcCCcEEEEEeecCCceecc
Q 045545 1 MNTTRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAGAKEVHMRIASPPIIASC 80 (158)
Q Consensus 1 ~~~n~~~~r~~~~~~~k~R~~~~~~~~~~~~~~v~gk~vliVDDvi~TG~Tl~~~~~~L~~~Ga~~V~v~v~~~~~~~~~ 80 (158)
++||||+||+|++|+|..|...+++|++++...++||+|+||||.|.+|+|+...+++||++||++||+.+++||+.+||
T Consensus 313 liKNrYvgRTFI~P~q~~R~~~Vr~KLnpvr~~v~GKrVvlVDDSIVRGTTsr~IV~mlReAGAkEVHvriasP~i~~Pc 392 (470)
T COG0034 313 LIKNRYVGRTFIMPTQELREKGVRLKLNPVREVVKGKRVVLVDDSIVRGTTSRRIVQMLREAGAKEVHVRIASPPIRYPC 392 (470)
T ss_pred cccccccceeeeCCcHHHHHhhhhhhcCchHHHhCCCeEEEEccccccCccHHHHHHHHHHhCCCEEEEEecCCCccCCC
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeeecCCCHHHHHhcCccchhhheeeccCcccccChHHHHHHhcCCCCCcccccccCcCCcCcch
Q 045545 81 YYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKMLGDDSQNFCYACFSGKYPVKPEE 145 (158)
Q Consensus 81 ~~gi~~~~~~eli~~~~~~~~i~~~i~tdsi~~~sl~~l~~~~~~~~~~~~~~cf~~~y~~~~~~ 145 (158)
+||+++++..|+|+++.+.++|++.||+||+.|+|+++|.++++....++|.+||+|+||+...+
T Consensus 393 ~YGID~pt~~eLIA~~~~~eeI~~~IgaDSL~yLslegL~~aig~~~~~~c~~cFtG~Yp~~~~~ 457 (470)
T COG0034 393 FYGIDMPTREELIAANRTVEEIRKAIGADSLAYLSLEGLIKAIGRDNNDFCLACFTGEYPTGLPD 457 (470)
T ss_pred ccccCCCCHHHHhhCCCCHHHHHHHhCCCceeeecHHHHHHHhCCCccceeeEEecCccccCCcc
Confidence 99999999999999999999999999999999999999999998754689999999999999664
|
|
| >PRK06388 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06781 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07631 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07349 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07847 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09246 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08341 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07272 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02440 amidophosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK05793 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01134 purF amidophosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK09123 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08525 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A | Back alignment and domain information |
|---|
| >PRK04923 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK02269 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07199 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00553 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02297 ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >PRK02458 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK03092 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK00934 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK06827 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK01259 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >KOG1448 consensus Ribose-phosphate pyrophosphokinase [Nucleotide transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02812 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02369 ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00201 comF comF family protein | Back alignment and domain information |
|---|
| >PRK11595 DNA utilization protein GntX; Provisional | Back alignment and domain information |
|---|
| >TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1503 consensus Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism; Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate | Back alignment and domain information |
|---|
| >COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02238 hypoxanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15423 hypoxanthine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13812 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13811 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13809 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family | Back alignment and domain information |
|---|
| >TIGR01090 apt adenine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK07322 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02277 orotate phosphoribosyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK00455 pyrE orotate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02293 adenine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK06031 phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02304 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00129 upp uracil phosphoribosyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01091 upp uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >TIGR00336 pyrE orotate phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK12560 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3367 consensus Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13810 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01744 XPRTase xanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK09219 xanthine phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated | Back alignment and domain information |
|---|
| >PRK08558 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1926 Predicted phosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type | Back alignment and domain information |
|---|
| >PRK09213 pur operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK09177 xanthine-guanine phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG2236 Predicted phosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1712 consensus Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02541 uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C | Back alignment and domain information |
|---|
| >PF15609 PRTase_2: Phosphoribosyl transferase | Back alignment and domain information |
|---|
| >PF15610 PRTase_3: PRTase ComF-like | Back alignment and domain information |
|---|
| >KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 158 | ||||
| 1ao0_A | 459 | Glutamine Phosphoribosylpyrophosphate (Prpp) Amidot | 3e-43 | ||
| 1gph_1 | 465 | Structure Of The Allosteric Regulatory Enzyme Of Pu | 7e-43 | ||
| 1ecf_A | 504 | Escherichia Coli Glutamine Phosphoribosylpyrophosph | 2e-23 |
| >pdb|1AO0|A Chain A, Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase From B. Subtilis Complexed With Adp And Gmp Length = 459 | Back alignment and structure |
|
| >pdb|1GPH|1 Chain 1, Structure Of The Allosteric Regulatory Enzyme Of Purine Biosynthesis Length = 465 | Back alignment and structure |
| >pdb|1ECF|A Chain A, Escherichia Coli Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase Length = 504 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| 1ao0_A | 459 | Glutamine phosphoribosylpyrophosphate amidotransfe | 5e-90 | |
| 1ecf_A | 504 | Glutamine phosphoribosylpyrophosphate amidotransf; | 1e-80 | |
| 1wd5_A | 208 | Hypothetical protein TT1426; structural genomics, | 1e-05 | |
| 1u9y_A | 284 | RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy | 2e-05 | |
| 3lrt_A | 286 | Ribose-phosphate pyrophosphokinase; phosphoribosyl | 2e-05 | |
| 2ps1_A | 226 | Orotate phosphoribosyltransferase 1; alpha beta, o | 2e-04 | |
| 1dku_A | 317 | Protein (phosphoribosyl pyrophosphate synthetase); | 2e-04 | |
| 3mjd_A | 232 | Orotate phosphoribosyltransferase; IDP02311, csgid | 3e-04 | |
| 1vdm_A | 153 | Purine phosphoribosyltransferase; structural genom | 3e-04 | |
| 2xbu_A | 221 | Hypoxanthine-guanine phosphoribosyltransferase; gl | 6e-04 |
| >1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Length = 459 | Back alignment and structure |
|---|
Score = 268 bits (688), Expect = 5e-90
Identities = 82/152 (53%), Positives = 112/152 (73%), Gaps = 5/152 (3%)
Query: 5 RYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAGA 64
RY TFI+PSQ +R+ GV++KLS V GV+EGKRVV+VDDSIVRGTTS +IV +L+EAGA
Sbjct: 307 RYVGRTFIQPSQALREQGVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGA 366
Query: 65 KEVHMRIASPPIIASCYYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKMLG 124
EVH++I+SPPI C+YG+DT + EELI++ SVEEIR+ IG D+L+FL ++ L K +G
Sbjct: 367 TEVHVKISSPPIAHPCFYGIDTSTHEELIASSHSVEEIRQEIGADTLSFLSVEGLLKGIG 426
Query: 125 DDSQN----FCYACFSGKYPVK-PEEMKVKRV 151
+ C ACF+GKYP + ++ + V
Sbjct: 427 RKYDDSNCGQCLACFTGKYPTEIYQDTVLPHV 458
|
| >1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Length = 504 | Back alignment and structure |
|---|
| >1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 | Back alignment and structure |
|---|
| >1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Length = 284 | Back alignment and structure |
|---|
| >3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Length = 286 | Back alignment and structure |
|---|
| >2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Length = 226 | Back alignment and structure |
|---|
| >1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Length = 317 | Back alignment and structure |
|---|
| >3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Length = 232 | Back alignment and structure |
|---|
| >1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Length = 153 | Back alignment and structure |
|---|
| >2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Length = 221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| 1ecf_A | 504 | Glutamine phosphoribosylpyrophosphate amidotransf; | 99.96 | |
| 1ao0_A | 459 | Glutamine phosphoribosylpyrophosphate amidotransfe | 99.96 | |
| 3lrt_A | 286 | Ribose-phosphate pyrophosphokinase; phosphoribosyl | 99.6 | |
| 3dah_A | 319 | Ribose-phosphate pyrophosphokinase; pyrophosphoki | 99.6 | |
| 1dku_A | 317 | Protein (phosphoribosyl pyrophosphate synthetase); | 99.6 | |
| 3s5j_B | 326 | Ribose-phosphate pyrophosphokinase 1; nucleotide s | 99.58 | |
| 1u9y_A | 284 | RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy | 99.57 | |
| 2ji4_A | 379 | Phosphoribosyl pyrophosphate synthetase-associated | 99.48 | |
| 1a3c_A | 181 | PYRR, pyrimidine operon regulatory protein PYRR; t | 99.26 | |
| 1vdm_A | 153 | Purine phosphoribosyltransferase; structural genom | 99.22 | |
| 1ufr_A | 181 | TT1027, PYR mRNA-binding attenuation protein; pyri | 99.19 | |
| 1wd5_A | 208 | Hypothetical protein TT1426; structural genomics, | 99.16 | |
| 1tc1_A | 220 | Protein (hypoxanthine phosphoribosyltransferase); | 99.16 | |
| 1pzm_A | 211 | HGPRT, hypoxanthine-guanine phosphoribosyltransfer | 99.11 | |
| 1hgx_A | 183 | HGXPRTASE, hypoxanthine-guanine-xanthine phosphori | 99.11 | |
| 1w30_A | 201 | PYRR bifunctional protein; transferase, glycosyltr | 99.1 | |
| 2geb_A | 185 | Hypoxanthine-guanine phosphoribosyltransferase; HG | 99.09 | |
| 3o7m_A | 186 | Hypoxanthine phosphoribosyltransferase; hypoxanthi | 99.07 | |
| 2jbh_A | 225 | Phosphoribosyltransferase domain-containing prote; | 99.07 | |
| 2ywu_A | 181 | Hypoxanthine-guanine phosphoribosyltransferase; ro | 99.06 | |
| 1yfz_A | 205 | Hypoxanthine-guanine phosphoribosyltransferase; pr | 99.06 | |
| 2yzk_A | 178 | OPRT, oprtase, orotate phosphoribosyltransferase; | 99.05 | |
| 1fsg_A | 233 | HGPRTASE, hypoxanthine-guanine phosphoribosyltrans | 99.04 | |
| 3ohp_A | 177 | Hypoxanthine phosphoribosyltransferase; structural | 99.03 | |
| 3hvu_A | 204 | Hypoxanthine phosphoribosyltransferase; hypoxanthi | 99.03 | |
| 3m3h_A | 234 | OPRT, oprtase, orotate phosphoribosyltransferase; | 99.02 | |
| 3dez_A | 243 | OPRT, oprtase, orotate phosphoribosyltransferase; | 99.01 | |
| 1y0b_A | 197 | Xanthine phosphoribosyltransferase; purine metabol | 99.01 | |
| 1zn8_A | 180 | APRT, adenine phosphoribosyltransferase; glycosylt | 98.99 | |
| 2wns_A | 205 | Orotate phosphoribosyltransferase; alternative spl | 98.97 | |
| 1i5e_A | 209 | Uracil phosphoribosyltransferase; salvage pathway; | 98.95 | |
| 1vch_A | 175 | Phosphoribosyltransferase-related protein; structu | 98.94 | |
| 1z7g_A | 217 | HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos | 98.94 | |
| 3acd_A | 181 | Hypoxanthine-guanine phosphoribosyltransferase; ro | 98.91 | |
| 2aee_A | 211 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.88 | |
| 3ozf_A | 250 | Hypoxanthine-guanine-xanthine phosphoribosyltrans; | 98.87 | |
| 1qb7_A | 236 | APRT, adenine phosphoribosyltransferase; dinucleot | 98.84 | |
| 1g2q_A | 187 | Adenine phosphoribosyltransferase 1; dimer, single | 98.84 | |
| 2dy0_A | 190 | APRT, adenine phosphoribosyltransferase; structura | 98.84 | |
| 2p1z_A | 180 | Phosphoribosyltransferase; STRU genomics, PSI-2, p | 98.83 | |
| 2ps1_A | 226 | Orotate phosphoribosyltransferase 1; alpha beta, o | 98.82 | |
| 1o5o_A | 221 | Uracil phosphoribosyltransferase; TM0721, structur | 98.81 | |
| 1l1q_A | 186 | Adenine phosphoribosyltransferase; aprtase, giardi | 98.79 | |
| 2e55_A | 208 | Uracil phosphoribosyltransferase; structural genom | 98.75 | |
| 2xbu_A | 221 | Hypoxanthine-guanine phosphoribosyltransferase; gl | 98.73 | |
| 2ehj_A | 208 | Uracil phosphoribosyltransferase; structural genom | 98.69 | |
| 1v9s_A | 208 | Uracil phosphoribosyltransferase; pyrimidine salva | 98.68 | |
| 3mjd_A | 232 | Orotate phosphoribosyltransferase; IDP02311, csgid | 98.66 | |
| 1lh0_A | 213 | OMP synthase; loop closure, monomer closure, orota | 98.62 | |
| 3n2l_A | 238 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.58 | |
| 1o57_A | 291 | PUR operon repressor; purine operon repressor, hel | 98.57 | |
| 3qw4_B | 453 | UMP synthase; N-terminal orotidine monophosphate d | 98.51 | |
| 1bd3_D | 243 | Uprtase, uracil phosphoribosyltransferase; glycosy | 98.48 | |
| 1nul_A | 152 | XPRT, xanthine-guanine phosphoribosyltransferase; | 98.46 | |
| 1dqn_A | 230 | Guanine phosphoribosyltransferase; protein-inhibit | 98.26 | |
| 3dmp_A | 217 | Uracil phosphoribosyltransferase; structural genom | 98.18 | |
| 1xtt_A | 216 | Probable uracil phosphoribosyltransferase; tetrame | 97.88 | |
| 2k5c_A | 95 | Uncharacterized protein PF0385; structural genomic | 86.22 |
| >1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=1.1e-29 Score=224.62 Aligned_cols=151 Identities=38% Similarity=0.585 Sum_probs=136.1
Q ss_pred CCCccccceeeCCChhhhcccCceeeccccccCCCCEEEEEeccccccHHHHHHHHHHHHcCCcEEEEEeecCCceecce
Q 045545 2 NTTRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAGAKEVHMRIASPPIIASCY 81 (158)
Q Consensus 2 ~~n~~~~r~~~~~~~k~R~~~~~~~~~~~~~~v~gk~vliVDDvi~TG~Tl~~~~~~L~~~Ga~~V~v~v~~~~~~~~~~ 81 (158)
+||+|.+|+++++++.+|..+++.++.+..++++||+||||||+++||+|+.++++.|+++||++|++++++||+..||+
T Consensus 325 ~k~r~~~~t~i~~~~~~R~~~v~~~~~~~~~~v~Gk~VllVDDii~TG~Tl~~~~~~L~~~Ga~~V~~~~l~~~~~~p~~ 404 (504)
T 1ecf_A 325 VKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNV 404 (504)
T ss_dssp EECSCCCCCCCCSSSCCCCCCSTTTEEECGGGTTTCCEEEEESCCSSSHHHHHHHHHHHHTTCSSEEEEESSCCCCSCCC
T ss_pred EEecccCCceeCccHHHHHHHHHhhhccccccCCCCeEEEEeccccccHHHHHHHHHHHhcCCcEEEEEEEecCcccCCe
Confidence 68999999999988888877776666555678999999999999999999999999999999999999999999999999
Q ss_pred eeecCCCHHHHHhcCccchhhheeeccCcccccChHHHHHHhcCCC---CCcccccccCcCCcC-cchhhhhhcc
Q 045545 82 YGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKMLGDDS---QNFCYACFSGKYPVK-PEEMKVKRVG 152 (158)
Q Consensus 82 ~gi~~~~~~eli~~~~~~~~i~~~i~tdsi~~~sl~~l~~~~~~~~---~~~~~~cf~~~y~~~-~~~~~~~~~~ 152 (158)
+|++.++..+++..+.+.+++.+.++.|++.++|+++|+++++... .++|++||+|+||++ +++.+++.|.
T Consensus 405 ~gi~~~~~~~lv~~~~~~~e~~~~~~~~~l~~~s~~~l~~~~~~~~~~~~~~~~~cf~g~y~~~~~~~~~~~~~~ 479 (504)
T 1ecf_A 405 YGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFECSVFNGVYVTKDVDQGYLDFLD 479 (504)
T ss_dssp SSCCCCCGGGCTTTTCCHHHHHHHHTCSEEEECCHHHHHHHHHTTCTTCCCCBCHHHHCCCTTSCCCHHHHHHHH
T ss_pred EEEEcCChHHeEEcCCCHHHHHHHcCCCEEEEEcHHHHHHHhccCCCccCCccceeCCCCCcCCCCCHHHHHHHH
Confidence 9999999889998888878899999999999999999999997642 379999999999999 8887776654
|
| >1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* | Back alignment and structure |
|---|
| >3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* | Back alignment and structure |
|---|
| >3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* | Back alignment and structure |
|---|
| >3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A | Back alignment and structure |
|---|
| >1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* | Back alignment and structure |
|---|
| >2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* | Back alignment and structure |
|---|
| >1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* | Back alignment and structure |
|---|
| >1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* | Back alignment and structure |
|---|
| >1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 | Back alignment and structure |
|---|
| >2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* | Back alignment and structure |
|---|
| >2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A | Back alignment and structure |
|---|
| >3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A | Back alignment and structure |
|---|
| >3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* | Back alignment and structure |
|---|
| >3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* | Back alignment and structure |
|---|
| >3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* | Back alignment and structure |
|---|
| >1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* | Back alignment and structure |
|---|
| >2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* | Back alignment and structure |
|---|
| >3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* | Back alignment and structure |
|---|
| >2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* | Back alignment and structure |
|---|
| >1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* | Back alignment and structure |
|---|
| >1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A | Back alignment and structure |
|---|
| >2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* | Back alignment and structure |
|---|
| >1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* | Back alignment and structure |
|---|
| >2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* | Back alignment and structure |
|---|
| >2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} | Back alignment and structure |
|---|
| >1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A | Back alignment and structure |
|---|
| >3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* | Back alignment and structure |
|---|
| >3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} | Back alignment and structure |
|---|
| >1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* | Back alignment and structure |
|---|
| >1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* | Back alignment and structure |
|---|
| >1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* | Back alignment and structure |
|---|
| >3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* | Back alignment and structure |
|---|
| >2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 158 | ||||
| d1gph11 | 231 | c.61.1.1 (1:235-465) Glutamine PRPP amidotransfera | 1e-36 | |
| d1ecfa1 | 243 | c.61.1.1 (A:250-492) Glutamine PRPP amidotransfera | 3e-36 | |
| d1wd5a_ | 208 | c.61.1.1 (A:) Putative phosphoribosyltransferase T | 4e-12 | |
| d1vcha1 | 174 | c.61.1.1 (A:2-175) Putative phosphoribosyltransfer | 8e-08 | |
| d2c4ka2 | 184 | c.61.1.2 (A:167-350) PRPP synthetase-associated pr | 8e-07 | |
| d1y0ba1 | 191 | c.61.1.1 (A:1-191) Xanthine phosphoribosyltransfer | 4e-06 | |
| d1dkua2 | 149 | c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate s | 2e-05 |
| >d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PRTase-like superfamily: PRTase-like family: Phosphoribosyltransferases (PRTases) domain: Glutamine PRPP amidotransferase, C-terminal domain species: Bacillus subtilis [TaxId: 1423]
Score = 123 bits (311), Expect = 1e-36
Identities = 83/158 (52%), Positives = 115/158 (72%), Gaps = 5/158 (3%)
Query: 1 MNTTRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLK 60
+ RY TFI+PSQ +R+ GV++KLS V GV+EGKRVV+VDDSIVRGTTS +IV +L+
Sbjct: 69 LIKNRYVGRTFIQPSQALREQGVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLR 128
Query: 61 EAGAKEVHMRIASPPIIASCYYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLN 120
EAGA EVH++I+SPPI C+YG+DT + EELI++ SV+EIR+ IG D+L+FL ++ L
Sbjct: 129 EAGATEVHVKISSPPIAHPCFYGIDTSTHEELIASSHSVDEIRQEIGADTLSFLSVEGLL 188
Query: 121 KMLG----DDSQNFCYACFSGKYPVK-PEEMKVKRVGE 153
K +G D + C ACF+GKYP + ++ + V E
Sbjct: 189 KGIGRKYDDSNCGQCLACFTGKYPTEIYQDTVLPHVKE 226
|
| >d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 243 | Back information, alignment and structure |
|---|
| >d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Length = 208 | Back information, alignment and structure |
|---|
| >d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
|---|
| >d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 184 | Back information, alignment and structure |
|---|
| >d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 191 | Back information, alignment and structure |
|---|
| >d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Length = 149 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| d1gph11 | 231 | Glutamine PRPP amidotransferase, C-terminal domain | 100.0 | |
| d1ecfa1 | 243 | Glutamine PRPP amidotransferase, C-terminal domain | 100.0 | |
| d1u9ya2 | 129 | Phosphoribosylpyrophosphate synthetase {Methanocal | 99.83 | |
| d1dkua2 | 149 | Phosphoribosylpyrophosphate synthetase {Bacillus s | 99.81 | |
| d2c4ka2 | 184 | PRPP synthetase-associated protein 1 {Human (Homo | 99.71 | |
| d1wd5a_ | 208 | Putative phosphoribosyltransferase TT1426 (TTHA146 | 99.16 | |
| d1vdma1 | 153 | Pprobable purine phosphoribosyltransferase PH0095 | 99.03 | |
| d1yfza1 | 178 | Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac | 98.95 | |
| d1tc1a_ | 184 | Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 | 98.94 | |
| d1pzma_ | 183 | Hypoxanthine-guanine-xanthine PRTase {Leishmania t | 98.93 | |
| d1j7ja_ | 172 | Hypoxanthine PRTase {Salmonella typhimurium [TaxId | 98.88 | |
| d1ufra_ | 178 | Pyrimidine operon regulator PyrR {Thermus thermoph | 98.86 | |
| d1cjba_ | 228 | Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium | 98.83 | |
| d1z7ga1 | 214 | Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom | 98.82 | |
| d1w30a_ | 182 | Pyrimidine operon regulator PyrR {Mycobacterium tu | 98.81 | |
| d1fsga_ | 233 | Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g | 98.79 | |
| d1a3ca_ | 178 | Pyrimidine operon regulator PyrR {Bacillus subtili | 98.79 | |
| d1hgxa_ | 173 | Hypoxanthine-guanine-xanthine PRTase {Tritrichomon | 98.75 | |
| d2aeea1 | 208 | Orotate PRTase {Streptococcus pyogenes [TaxId: 131 | 98.74 | |
| d1vcha1 | 174 | Putative phosphoribosyltransferase TTHA1613 {Therm | 98.72 | |
| d1qb7a_ | 236 | Adenine PRTase {Leishmania donovani [TaxId: 5661]} | 98.59 | |
| d1g2qa_ | 178 | Adenine PRTase {Baker's yeast (Saccharomyces cerev | 98.56 | |
| d1zn7a1 | 178 | Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] | 98.53 | |
| d1l1qa_ | 181 | Adenine PRTase {Giardia lamblia [TaxId: 5741]} | 98.52 | |
| d1lh0a_ | 213 | Orotate PRTase {Salmonella typhimurium [TaxId: 903 | 98.5 | |
| d1y0ba1 | 191 | Xanthine phosphoribosyltransferase {Bacillus subti | 98.47 | |
| d1o57a2 | 202 | Pur operon repressor (PurR), C-terminal domain {Ba | 98.43 | |
| d1dqna_ | 230 | Guanine PRTase {Giardia lamblia [TaxId: 5741]} | 98.41 | |
| d1nula_ | 150 | Xanthine-guanine PRTase (XPRTase) {Escherichia col | 97.91 | |
| d1i5ea_ | 208 | Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: | 97.54 | |
| d1o5oa_ | 210 | Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 | 97.41 | |
| d1v9sa1 | 208 | Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 | 97.31 | |
| d1bd3a_ | 224 | Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 | 96.99 | |
| d1xtta1 | 215 | Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId | 96.63 |
| >d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PRTase-like superfamily: PRTase-like family: Phosphoribosyltransferases (PRTases) domain: Glutamine PRPP amidotransferase, C-terminal domain species: Bacillus subtilis [TaxId: 1423]
Probab=100.00 E-value=1.3e-37 Score=250.19 Aligned_cols=155 Identities=54% Similarity=0.892 Sum_probs=144.0
Q ss_pred CCCCccccceeeCCChhhhcccCceeeccccccCCCCEEEEEeccccccHHHHHHHHHHHHcCCcEEEEEeecCCceecc
Q 045545 1 MNTTRYEHETFIEPSQKIRDFGVKLKLSPVTGVLEGKRVVVVDDSIVRGTTSSKIVRLLKEAGAKEVHMRIASPPIIASC 80 (158)
Q Consensus 1 ~~~n~~~~r~~~~~~~k~R~~~~~~~~~~~~~~v~gk~vliVDDvi~TG~Tl~~~~~~L~~~Ga~~V~v~v~~~~~~~~~ 80 (158)
++||+|.+|+|++|+|+.|...++.+++++.+.++||+|+||||.|.+|+|+...+++|+++||++||+++++||+.+||
T Consensus 69 ~ikn~~~~RtFI~p~~~~R~~~v~~K~~~~~~~i~gK~vvlVDDSIVRGtT~k~iv~~lr~aGakeVh~~i~sPpi~~pc 148 (231)
T d1gph11 69 LIKNRYVGRTFIQPSQALREQGVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHVKISSPPIAHPC 148 (231)
T ss_dssp EEECTTCSTTCCCCCHHHHHHTCCCSEEECHHHHTTCEEEEEESCCSSSHHHHHHHHHHHHTTCSEEEEEESSCCCCSCC
T ss_pred ceehhhhhhccCCCchHHHHHHHHHhhhhhhheeccCceEEeehhhhccchHHHHHHHHHHcCCCeEEEEecccceeeee
Confidence 47999999999999999999999999988888999999999999999999999999999999999999999999999999
Q ss_pred eeeecCCCHHHHHhcCccchhhheeeccCcccccChHHHHHHhcCC----CCCcccccccCcCCcCcc-hhhhhhccccc
Q 045545 81 YYGVDTPSSEELISNRMSVEEIREFIGCDSLAFLLIDSLNKMLGDD----SQNFCYACFSGKYPVKPE-EMKVKRVGEFV 155 (158)
Q Consensus 81 ~~gi~~~~~~eli~~~~~~~~i~~~i~tdsi~~~sl~~l~~~~~~~----~~~~~~~cf~~~y~~~~~-~~~~~~~~~~~ 155 (158)
+||++++...|+++++.+.++|++.+++|||.|+|+++|.++++.. ...+|++||+|+||+++. +.+++.|.|-.
T Consensus 149 ~yGID~p~~~ELIA~~~t~eEI~~~igaDSL~Ylsle~L~~ai~~~~~~~~~~~C~aCFtG~YPt~~~~e~~~~~lee~~ 228 (231)
T d1gph11 149 FYGIDTSTHEELIASSHSVDEIRQEIGADTLSFLSVEGLLKGIGRKYDDSNCGQCLACFTGKYPTEIYQDTVLPHVKEAV 228 (231)
T ss_dssp CSCGGGCCSSCCHHHHCCHHHHHHHHTCSEEEECCHHHHHHHHCCCCSSTTTTEECHHHHSCCSSCCCTTCCCGGGGCCB
T ss_pred eeccccccchhhhhcccCHHHHHhhhcCCeeEeccHHHHHHHHhcccCCCCCCcCCeeeCCeecCCCCCHhHHHHHHHHh
Confidence 9999999999999999999999999999999999999999999653 235899999999999985 55777776643
|
| >d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} | Back information, alignment and structure |
|---|
| >d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} | Back information, alignment and structure |
|---|
| >d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} | Back information, alignment and structure |
|---|
| >d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} | Back information, alignment and structure |
|---|
| >d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} | Back information, alignment and structure |
|---|
| >d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|