Citrus Sinensis ID: 045554

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---

MAITSILNSNRLLLSKRTVNCFDGNLLRYNVIKSLSFRPVIPDPGPKLSSLQAKTFLMNPTTPILTSSSEANSRTPSNRDLKVQQSVGVMMGGRSFPLIFTNPNQNPNPNRLQVSIGAALFFVLVGLFLFLLSSGQIAGLQQKVLDLSHLLTETTKSLFLGHDTQRWISDYSPVTMSMSMLLAGPKRIKFPKQHRGRMTGKASRGNLICFGRYALQALEPAWITARQIEAGRRAMVRNVKRGGKIWVRIFPDKPVTARPAETRMGSGKGSHAYWAAVVTPGKIIFEMSGVPENIARKAISIAASKMPIKTQFVMSGTSTSKDE

ccEEEccccccEEEEccEEEcccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEECccccCEEEECccccccccccCEEEHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccHHHHHcccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccEEEEEEcccEEEEEEccccHHHHHHHHHHHHcccccEEEEEEccccccccc

**ITSILNSNRLLLSKRTVNCFDGNLLRYNVIKSLSFRPVIPDPGPKLSSLQAKTFLMNPTTP********************QQSVGVMMGGRSFPLIFTNPNQNPNPNRLQVSIGAALFFVLVGLFLFLLSSGQIAGLQQKVLDLSHLLTETTKSLFLGHDTQRWISDYSPVTMSMSMLLAGPKRIKFPKQHRGRMTGKASRGNLICFGRYALQALEPAWITARQIEAGRRAMVRNVKRGGKIWVRIFPDKPVTARPAE****SGKGSHAYWAAVVTPGKIIFEMSGVPENIARKAISIAASKMPIKTQF***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L16, chloroplastic		probable	Q2PMP8
50S ribosomal protein L16, chloroplastic		probable	Q0ZIY1
50S ribosomal protein L16, chloroplastic		probable	P56793

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain O
Confidence level:very confident
Coverage over the Query: 182-315
View the alignment between query and template
View the model in PyMOL