Citrus Sinensis ID: 045638

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MGVKEEFDARISRPRRKKRKEKKEGKEGNGRKGELYVVEVVEEERKEMSGLLGDEFRGGEKWRGSTRLLLLDEEFVDKNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAMTEFLYRLQPLLSLRMALKYSVSPSIPCSGSTVGKVYHWSHLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGDVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPESVVFARRSPNT
ccccccccccccccHHHHHHHHccccccccccccEEEEEEEEccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccccEEEEEEEEEEEccccccHHHHHHHHcccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEccccEEEEEEcccEEEEEEEEEccccccEEEcccccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHccccccccccccEEEEEcccccccccHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEcccccccccccccc
ccccEHcccccccccHHHHccccccccccccccEEEEEEEEEcccccccccccccccccccccccEEEEEEccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccEEEccccccccccccHcccccccccHHHHHHHHHHcHHHHccccccEEEEEEEEEEcccccHHHHHHHHcccccccccccHEEEEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHcccccEEEEEEccccccEHHHcccccEEEEccccHHHHHHHHHHHHHccccccEEEccccHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHccccccccccccEEEEEEcccccccHHHHHHHHHHHHccccccEEEEEEEEccccccEEEEEEEccHHHHcccccccc
MGVKEEFDarisrprrkkrkekkegkegngrkgeLYVVEVVEEERKEMSgllgdefrggekwrgstrlllldeefvdkNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAMTEFLYRLQPLLSLRMALkysvspsipcsgstvgkvyhwshlygrgtecfqlevcnvdeafdfHSYVQILEALlpkgmiipsafetvgHIAHLnlreehqpFKYLIAKVVldknkpkiQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGdvfagvgpisipAAKIVKRVyandlnpyavdYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGiyrdrpedvkftfpkthvygfskardpefdfHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFvlpesvvfarrspnt
mgvkeefdarisrprrkkrkekkegkegngrkgelyvVEVVEEERKemsgllgdefrggekwrGSTRLLLLDEEFVDKNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAMTEFLYRLQPLLSLRMALKYSVSPSIPCSGSTVGKVYHWSHLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKvvldknkpkiQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGDVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRdrpedvkftfpkthvygfskardpefDFHERIRIALaevavnveMRRVRLVAPGKWMLFasfvlpesvvfarrspnt
MGVKEEFDARISRPrrkkrkekkegkegngrkgeLYvvevveeeRKEMSGLLGDEFRGGEKWRGSTRLLLLDEEFVDKNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAMTEFLYRLQPLLSLRMALKYSVSPSIPCSGSTVGKVYHWSHLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGDVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPESVVFARRSPNT
**********************************LYVVEVV*********LLGDEFRGGEKWRGSTRLLLLDEEFVDKNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAMTEFLYRLQPLLSLRMALKYSVSPSIPCSGSTVGKVYHWSHLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGDVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPESVVFA******
************************************VVEVVEEERKEMSGLLGDEFRGGEKWRGSTRLLLLDEEFVDKNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAM*E****************YSV**SI************W*HLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGDVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPESVV*A******
******************************RKGELYVVEVVEEERKEMSGLLGDEFRGGEKWRGSTRLLLLDEEFVDKNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAMTEFLYRLQPLLSLRMALKYSVSPSIPCSGSTVGKVYHWSHLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGDVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPESVVFARRSPNT
*********RIS******************RKGELYVVEVVEEERKEMSGLLGDEFRGGEKWRGSTRLLLLDEEFVDKNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAMTEFLYRLQPLLSLRMALKYSVSPSIPCSGSTVGKVYHWSHLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGDVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPESVVFAR*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVKEEFDARISRPRRKKRKEKKEGKEGNGRKGELYVVEVVEEERKEMSGLLGDEFRGGEKWRGSTRLLLLDEEFVDKNVLRFHILALAKHYIHCLGFYSKHIQFLSKNELNWAMTEFLYRLQPLLSLRMALKYSVSPSIPCSGSTVGKVYHWSHLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAYMCESLFFVQMTGDVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPESVVFARRSPNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
F6H2F8608 tRNA (guanine(37)-N1)-met yes no 0.622 0.447 0.643 1e-106
Q6NQ64619 tRNA (guanine(37)-N1)-met yes no 0.622 0.439 0.617 1e-104
B8A5G9480 tRNA (guanine(37)-N1)-met yes no 0.558 0.508 0.399 3e-47
F6VSS6494 tRNA (guanine(37)-N1)-met yes no 0.574 0.508 0.393 5e-46
D0NLC2411 tRNA (guanine(37)-N1)-met N/A no 0.572 0.608 0.399 5e-45
Q9D0C4501 tRNA (guanine(37)-N1)-met yes no 0.613 0.534 0.359 5e-43
Q3MHN8497 tRNA (guanine(37)-N1)-met yes no 0.615 0.541 0.349 2e-42
F4NUJ6475 tRNA (guanine(37)-N1)-met N/A no 0.583 0.536 0.377 1e-41
D3BT31426 tRNA (guanine(37)-N1)-met N/A no 0.562 0.577 0.36 1e-41
Q95KJ2509 tRNA (guanine(37)-N1)-met N/A no 0.613 0.526 0.355 2e-41
>sp|F6H2F8|TRM51_VITVI tRNA (guanine(37)-N1)-methyltransferase 1 OS=Vitis vinifera GN=VIT_19s0014g03930 PE=3 SV=1 Back     alignment and function desciption
 Score =  387 bits (993), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 229/306 (74%), Gaps = 34/306 (11%)

Query: 161 TECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLI 220
           T  F+L  C +   +++    +ILEALLP+GMI+PSAFE VGHIAHLNLR+EH P+K LI
Sbjct: 298 TSTFELVKCKLTLFYNYWQMNEILEALLPEGMIVPSAFEMVGHIAHLNLRDEHLPYKKLI 357

Query: 221 AKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLE---GDAYMCESL------FFVQMTG--- 268
           AKVVLDKNKPKIQTVVNK DAIHNDYRTMQLE   G+  +  ++      F V +     
Sbjct: 358 AKVVLDKNKPKIQTVVNKTDAIHNDYRTMQLEVLAGNRSLVTTVIENGMRFQVDLATVYW 417

Query: 269 ----------------------DVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSV 306
                                 DVF+GVGPI+I AAK VKRVYANDLNPYA++YLE NSV
Sbjct: 418 NSRLATERQRLLNCFTRNDVVCDVFSGVGPIAISAAKKVKRVYANDLNPYAIEYLESNSV 477

Query: 307 LNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDV 366
           LNKLE+KI+VFNMDGRRFI+AMF S KA  ITQVVMNLPNDA EFLDAFRGI+R +  D 
Sbjct: 478 LNKLERKIKVFNMDGRRFINAMFTSDKAESITQVVMNLPNDAAEFLDAFRGIFRKKSRDK 537

Query: 367 KFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPE 426
           +   P  HVYGFSKA+DPEFDFH+RIRIAL+EVAV+VEM RVRLVAPGKWML ASF+LP+
Sbjct: 538 QLKLPMIHVYGFSKAQDPEFDFHQRIRIALSEVAVDVEMHRVRLVAPGKWMLRASFILPK 597

Query: 427 SVVFAR 432
           SVVFA+
Sbjct: 598 SVVFAK 603
Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding.
Vitis vinifera (taxid: 29760)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 2EC: 8
>sp|Q6NQ64|TRM52_ARATH tRNA (guanine(37)-N1)-methyltransferase 2 OS=Arabidopsis thaliana GN=At4g27340 PE=2 SV=1 Back     alignment and function description
>sp|B8A5G9|TRM5_DANRE tRNA (guanine(37)-N1)-methyltransferase OS=Danio rerio GN=trmt5 PE=2 SV=1 Back     alignment and function description
>sp|F6VSS6|TRM5_XENTR tRNA (guanine(37)-N1)-methyltransferase OS=Xenopus tropicalis GN=trmt5 PE=3 SV=1 Back     alignment and function description
>sp|D0NLC2|TRM5_PHYIT tRNA (guanine(37)-N1)-methyltransferase OS=Phytophthora infestans (strain T30-4) GN=PITG_12867 PE=3 SV=1 Back     alignment and function description
>sp|Q9D0C4|TRM5_MOUSE tRNA (guanine(37)-N1)-methyltransferase OS=Mus musculus GN=Trmt5 PE=2 SV=1 Back     alignment and function description
>sp|Q3MHN8|TRM5_BOVIN tRNA (guanine(37)-N1)-methyltransferase OS=Bos taurus GN=TRMT5 PE=2 SV=1 Back     alignment and function description
>sp|F4NUJ6|TRM5_BATDJ tRNA (guanine(37)-N1)-methyltransferase OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=TRM5 PE=3 SV=1 Back     alignment and function description
>sp|D3BT31|TRM5_POLPA tRNA (guanine(37)-N1)-methyltransferase OS=Polysphondylium pallidum GN=trmt5 PE=3 SV=1 Back     alignment and function description
>sp|Q95KJ2|TRM5_MACFA tRNA (guanine(37)-N1)-methyltransferase OS=Macaca fascicularis GN=TRMT5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
124359271344 SAM (and some other nucleotide) binding 0.675 0.857 0.639 1e-110
302143105375 unnamed protein product [Vitis vinifera] 0.622 0.725 0.643 1e-105
225461279 608 PREDICTED: tRNA (guanine-N(1)-)-methyltr 0.622 0.447 0.643 1e-105
255569649 641 conserved hypothetical protein [Ricinus 0.826 0.563 0.502 1e-104
356542234 594 PREDICTED: tRNA (guanine-N(1)-)-methyltr 0.629 0.462 0.627 1e-104
297799252 617 hypothetical protein ARALYDRAFT_492065 [ 0.622 0.440 0.620 1e-103
42567181 619 Met-10+ like family protein [Arabidopsis 0.622 0.439 0.617 1e-102
356549789 601 PREDICTED: tRNA (guanine-N(1)-)-methyltr 0.643 0.467 0.608 1e-102
449458211 626 PREDICTED: tRNA (guanine(37)-N1)-methylt 0.624 0.436 0.636 1e-100
357132197 575 PREDICTED: tRNA (guanine-N(1)-)-methyltr 0.627 0.476 0.584 4e-95
>gi|124359271|gb|ABN05774.1| SAM (and some other nucleotide) binding motif [Medicago truncatula] Back     alignment and taxonomy information
 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 211/330 (63%), Positives = 242/330 (73%), Gaps = 35/330 (10%)

Query: 142 CSGSTVGKVYHWSHLYGRGTECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETV 201
           CSG  V  V    +        F+L  C +   +D+    +ILEALLP+GMI+P+ FETV
Sbjct: 16  CSGRCVEAVLK-EYAEKSSPLTFELVRCKLTLFYDYWQTNEILEALLPEGMIVPTTFETV 74

Query: 202 GHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLE---GDAYMC 258
           GHIAHLNLREEH P+K LIAKVVLDKNKPKIQTV NKID+IHN+YRTMQLE   G+  + 
Sbjct: 75  GHIAHLNLREEHLPYKKLIAKVVLDKNKPKIQTVANKIDSIHNEYRTMQLEVLAGNHSLV 134

Query: 259 ESL------FFVQMT-------------------------GDVFAGVGPISIPAAKIVKR 287
            +L      F V +                           DVFAGVGP++I AAKIVKR
Sbjct: 135 TTLAENGLRFHVDLAIVYWNSRLGTERQRLLSGFTRNDVVCDVFAGVGPLAISAAKIVKR 194

Query: 288 VYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPND 347
           V+ANDLNP+AV+YLERNSVLNKLEKKI+VF MDGRRFI AMFAS KAH ITQVVMNLPND
Sbjct: 195 VFANDLNPHAVEYLERNSVLNKLEKKIKVFKMDGRRFIMAMFASDKAHSITQVVMNLPND 254

Query: 348 ATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEVAVNVEMRR 407
           A EFLDAFRGIY+DRP+D +FT+P  HVYGFSKA DPEFDFHERIRIAL EVAVNV+MRR
Sbjct: 255 AAEFLDAFRGIYKDRPKDGEFTYPMIHVYGFSKAEDPEFDFHERIRIALLEVAVNVDMRR 314

Query: 408 VRLVAPGKWMLFASFVLPESVVFARRSPNT 437
           VRLVAPGKWML ASF+LP+SV FA  + +T
Sbjct: 315 VRLVAPGKWMLCASFILPKSVAFANTAVDT 344

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302143105|emb|CBI20400.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225461279|ref|XP_002284299.1| PREDICTED: tRNA (guanine-N(1)-)-methyltransferase-like [Vitis vinifera] gi|363805566|sp|F6H2F8.1|TRM51_VITVI RecName: Full=tRNA (guanine(37)-N1)-methyltransferase 1; AltName: Full=M1G-methyltransferase 1; AltName: Full=tRNA [GM37] methyltransferase 1; AltName: Full=tRNA methyltransferase 5 homolog 1 Back     alignment and taxonomy information
>gi|255569649|ref|XP_002525790.1| conserved hypothetical protein [Ricinus communis] gi|223534940|gb|EEF36626.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356542234|ref|XP_003539574.1| PREDICTED: tRNA (guanine-N(1)-)-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|297799252|ref|XP_002867510.1| hypothetical protein ARALYDRAFT_492065 [Arabidopsis lyrata subsp. lyrata] gi|297313346|gb|EFH43769.1| hypothetical protein ARALYDRAFT_492065 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42567181|ref|NP_194464.3| Met-10+ like family protein [Arabidopsis thaliana] gi|75127148|sp|Q6NQ64.1|TRM52_ARATH RecName: Full=tRNA (guanine(37)-N1)-methyltransferase 2; AltName: Full=M1G-methyltransferase 2; AltName: Full=tRNA [GM37] methyltransferase 2; AltName: Full=tRNA methyltransferase 5 homolog 2; Flags: Precursor gi|37202010|gb|AAQ89620.1| At4g27340 [Arabidopsis thaliana] gi|110742288|dbj|BAE99069.1| hypothetical protein [Arabidopsis thaliana] gi|332659926|gb|AEE85326.1| Met-10+ like family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356549789|ref|XP_003543273.1| PREDICTED: tRNA (guanine-N(1)-)-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|449458211|ref|XP_004146841.1| PREDICTED: tRNA (guanine(37)-N1)-methyltransferase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357132197|ref|XP_003567718.1| PREDICTED: tRNA (guanine-N(1)-)-methyltransferase-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
TAIR|locus:2131744619 AT4G27340 [Arabidopsis thalian 0.379 0.268 0.734 1.9e-106
ZFIN|ZDB-GENE-030131-5978481 trmt5 "TRM5 tRNA methyltransfe 0.370 0.336 0.440 1.9e-46
UNIPROTKB|F1NFG8500 TRMT5 "Uncharacterized protein 0.379 0.332 0.412 2.4e-40
UNIPROTKB|Q3MHN8497 TRMT5 "tRNA (guanine(37)-N1)-m 0.379 0.334 0.377 3.2e-40
MGI|MGI:1923607501 Trmt5 "TRM5 tRNA methyltransfe 0.377 0.329 0.386 5.6e-40
UNIPROTKB|I3L8T3499 TRMT5 "Uncharacterized protein 0.375 0.328 0.373 4.3e-39
UNIPROTKB|Q32P41509 TRMT5 "tRNA (guanine(37)-N1)-m 0.377 0.324 0.4 6e-39
POMBASE|SPAPB18E9.01450 trm5 "tRNA (guanine) methyltra 0.176 0.171 0.55 1.7e-38
DICTYBASE|DDB_G0279739460 trmt5 "tRNA (guanine-N1-)-meth 0.354 0.336 0.395 2e-38
UNIPROTKB|J9P7M6495 TRMT5 "Uncharacterized protein 0.379 0.335 0.366 4.3e-38
TAIR|locus:2131744 AT4G27340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 658 (236.7 bits), Expect = 1.9e-106, Sum P(3) = 1.9e-106
 Identities = 122/166 (73%), Positives = 148/166 (89%)

Query:   269 DVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAM 328
             DVFAGVGPI++ AA+IVKRVYANDLNP+AV+++E+NSV+NKLEK+IE+FNMDGRRFI AM
Sbjct:   449 DVFAGVGPIALAAARIVKRVYANDLNPHAVEFMEQNSVVNKLEKRIEIFNMDGRRFIKAM 508

Query:   329 FASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDF 388
             F+S+K  K+TQVVMNLP DA E LDAFRG+Y DR  D   +FP  HVYGFSKA DPEFDF
Sbjct:   509 FSSEKGQKVTQVVMNLPKDAAESLDAFRGVYNDRHRDEGLSFPTIHVYGFSKASDPEFDF 568

Query:   389 HERIRIALAEVAVNVEMRRVRLVAPGKWMLFASFVLPESVVFARRS 434
             HERIRIAL+EVAV+V+MR+VRLVAPGKWML ASF+LP++V F+R++
Sbjct:   569 HERIRIALSEVAVDVKMRKVRLVAPGKWMLCASFILPKNVAFSRKN 614
GO:0016740 "transferase activity" evidence=IEA
ZFIN|ZDB-GENE-030131-5978 trmt5 "TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFG8 TRMT5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHN8 TRMT5 "tRNA (guanine(37)-N1)-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1923607 Trmt5 "TRM5 tRNA methyltransferase 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3L8T3 TRMT5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q32P41 TRMT5 "tRNA (guanine(37)-N1)-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAPB18E9.01 trm5 "tRNA (guanine) methyltransferase Trm5 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279739 trmt5 "tRNA (guanine-N1-)-methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7M6 TRMT5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!
3rd Layer2.1.1.31LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
COG2520341 COG2520, COG2520, Predicted methyltransferase [Gen 5e-37
pfam02475199 pfam02475, Met_10, Met-10+ like-protein 9e-34
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 4e-05
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases re 5e-05
TIGR00308 374 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltran 5e-05
COG4076252 COG4076, COG4076, Predicted RNA methylase [General 7e-05
pfam02005 375 pfam02005, TRM, N2,N2-dimethylguanosine tRNA methy 9e-05
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 2e-04
COG1867 380 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyl 2e-04
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltrans 6e-04
TIGR00479431 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransf 0.004
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [G 0.004
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 0.004
>gnl|CDD|225318 COG2520, COG2520, Predicted methyltransferase [General function prediction only] Back     alignment and domain information 
 Score =  137 bits (348), Expect = 5e-37
 Identities = 77/273 (28%), Positives = 124/273 (45%), Gaps = 55/273 (20%)

Query: 183 ILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAI 242
           + E +L +  ++PS+F+ +G IA L++ +E +P+K  IA+ +L  +  K++ V+ K   +
Sbjct: 77  LPEEVLRE--LVPSSFDIIGDIAILSIPDELEPYKREIAEAILRVH-GKVKAVLLKEGPV 133

Query: 243 HNDYRTMQLE---GD--------------------AYMCESLFF-----VQMTG------ 268
             ++R  +LE   G+                     Y    L        ++        
Sbjct: 134 AGEFRVPRLEVLAGERRTETIHRENGCRFKVDVAKVYFSPRLSTERARVAELVKEGETVL 193

Query: 269 DVFAGVGPISIPAAKIVKR-VYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDA 327
           D+FAGVGP SIP AK  +  VYA D+NP AV+YL+ N  LNK+E ++E    D R     
Sbjct: 194 DMFAGVGPFSIPIAKKGRPKVYAIDINPDAVEYLKENIRLNKVEGRVEPILGDAREVA-- 251

Query: 328 MFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFD 387
                +     +++M LP  A EFL     + +D            H Y F    D E  
Sbjct: 252 ----PELGVADRIIMGLPKSAHEFLPLALELLKDG--------GIIHYYEFVPEDDIEER 299

Query: 388 FHERIRIALAEVAVNVE---MRRVRLVAPGKWM 417
             +RI+ A  +    VE   +RRV+  +PG + 
Sbjct: 300 PEKRIKSAARKGGYKVEVLKVRRVKSYSPGVYH 332

Length = 341
>gnl|CDD|202251 pfam02475, Met_10, Met-10+ like-protein Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225174 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232913 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>gnl|CDD|226562 COG4076, COG4076, Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216840 pfam02005, TRM, N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|224780 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>gnl|CDD|129571 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>gnl|CDD|226608 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
KOG2078495 consensus tRNA modification enzyme [RNA processing 100.0
COG2520341 Predicted methyltransferase [General function pred 100.0
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 100.0
KOG1227351 consensus Putative methyltransferase [General func 99.88
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.8
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.8
COG2265432 TrmA SAM-dependent methyltransferases related to t 99.7
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.7
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.65
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.64
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.62
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.58
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.55
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.55
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.54
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 99.53
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.49
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.48
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.48
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.46
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 99.42
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 99.41
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.41
COG4123248 Predicted O-methyltransferase [General function pr 99.4
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 99.33
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.32
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.31
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.26
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.25
COG2890280 HemK Methylase of polypeptide chain release factor 99.25
PRK14967223 putative methyltransferase; Provisional 99.24
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 99.22
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.22
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.2
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.2
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.19
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.19
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.18
KOG2078495 consensus tRNA modification enzyme [RNA processing 99.15
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.13
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.13
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.13
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.12
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.11
PRK14968188 putative methyltransferase; Provisional 99.1
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 99.1
COG2521287 Predicted archaeal methyltransferase [General func 99.09
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.08
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.07
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.07
PRK07402196 precorrin-6B methylase; Provisional 99.07
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.07
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.07
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.07
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.05
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.05
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.05
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.05
PRK14904445 16S rRNA methyltransferase B; Provisional 99.04
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 99.03
PRK14902444 16S rRNA methyltransferase B; Provisional 99.03
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.02
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 99.02
PRK11207197 tellurite resistance protein TehB; Provisional 99.02
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.02
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 99.01
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.0
PRK04266226 fibrillarin; Provisional 99.0
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.0
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.0
PRK14901434 16S rRNA methyltransferase B; Provisional 98.97
PLN02476278 O-methyltransferase 98.96
PRK10901427 16S rRNA methyltransferase B; Provisional 98.94
PRK14903431 16S rRNA methyltransferase B; Provisional 98.93
PRK12335287 tellurite resistance protein TehB; Provisional 98.93
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.93
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.92
PLN02244340 tocopherol O-methyltransferase 98.91
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.91
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.9
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.9
PHA03412241 putative methyltransferase; Provisional 98.9
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.89
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.89
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.88
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.88
PHA03411279 putative methyltransferase; Provisional 98.86
PLN02672 1082 methionine S-methyltransferase 98.83
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.83
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.81
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.8
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.8
PRK04457262 spermidine synthase; Provisional 98.79
KOG2730263 consensus Methylase [General function prediction o 98.79
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.78
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.78
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.77
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.77
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.76
PTZ00146293 fibrillarin; Provisional 98.75
PRK10742250 putative methyltransferase; Provisional 98.74
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.72
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.72
PLN02233261 ubiquinone biosynthesis methyltransferase 98.72
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.7
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.7
PRK00811283 spermidine synthase; Provisional 98.7
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.7
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.69
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.69
KOG2904328 consensus Predicted methyltransferase [General fun 98.67
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.66
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.65
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.64
COG1041347 Predicted DNA modification methylase [DNA replicat 98.64
COG4076252 Predicted RNA methylase [General function predicti 98.62
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.62
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.61
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.61
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.6
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.6
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.6
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.6
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.59
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.58
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.57
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.55
PRK03612521 spermidine synthase; Provisional 98.54
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.52
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.51
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.51
PLN02336475 phosphoethanolamine N-methyltransferase 98.5
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.5
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.49
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.48
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.48
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 98.48
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.48
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.46
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.45
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.44
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.44
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.42
PRK01581374 speE spermidine synthase; Validated 98.41
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.41
PLN02366308 spermidine synthase 98.4
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.39
PLN02336 475 phosphoethanolamine N-methyltransferase 98.36
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.35
PLN02589247 caffeoyl-CoA O-methyltransferase 98.35
PRK06922677 hypothetical protein; Provisional 98.34
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.34
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.32
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.3
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.28
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.28
PLN03075296 nicotianamine synthase; Provisional 98.27
PRK08317241 hypothetical protein; Provisional 98.27
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.25
COG4122219 Predicted O-methyltransferase [General function pr 98.24
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.23
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.23
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.22
TIGR00452314 methyltransferase, putative. Known examples to dat 98.19
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 98.19
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 98.18
PLN02823336 spermine synthase 98.17
TIGR00438188 rrmJ cell division protein FtsJ. 98.16
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.15
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.13
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.12
PRK05785226 hypothetical protein; Provisional 98.12
PLN02490340 MPBQ/MSBQ methyltransferase 98.11
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.1
TIGR03438301 probable methyltransferase. This model represents 98.09
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 98.09
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 98.08
PRK06202232 hypothetical protein; Provisional 98.07
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.04
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.04
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.04
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.03
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 98.0
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.99
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.97
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.96
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 97.94
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.94
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.93
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.87
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.87
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.84
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.84
KOG4300252 consensus Predicted methyltransferase [General fun 97.78
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 97.77
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.69
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.67
COG3897218 Predicted methyltransferase [General function pred 97.67
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 97.67
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.64
PRK04148134 hypothetical protein; Provisional 97.6
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 97.54
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.5
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.36
KOG2671421 consensus Putative RNA methylase [Replication, rec 97.29
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 97.28
COG4106257 Tam Trans-aconitate methyltransferase [General fun 97.22
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.22
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 97.21
PHA01634156 hypothetical protein 97.21
KOG1271227 consensus Methyltransferases [General function pre 97.19
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.14
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.06
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.01
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.0
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 96.99
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.98
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 96.87
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 96.87
COG4262508 Predicted spermidine synthase with an N-terminal m 96.84
PF13679141 Methyltransf_32: Methyltransferase domain 96.84
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 96.75
PRK10458 467 DNA cytosine methylase; Provisional 96.66
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 96.57
PRK11524284 putative methyltransferase; Provisional 96.53
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 96.5
PRK13699227 putative methylase; Provisional 96.49
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 96.28
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 96.28
KOG1501 636 consensus Arginine N-methyltransferase [General fu 96.28
KOG2361264 consensus Predicted methyltransferase [General fun 96.19
COG2384226 Predicted SAM-dependent methyltransferase [General 96.18
PLN02232160 ubiquinone biosynthesis methyltransferase 96.14
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.1
COG0286 489 HsdM Type I restriction-modification system methyl 96.08
PRK00536262 speE spermidine synthase; Provisional 95.9
KOG3010261 consensus Methyltransferase [General function pred 95.76
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 95.65
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 95.57
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 95.56
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 95.03
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 94.98
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 94.95
KOG2899288 consensus Predicted methyltransferase [General fun 94.88
PF02086260 MethyltransfD12: D12 class N6 adenine-specific DNA 94.74
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 94.74
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 94.55
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 94.42
KOG4058199 consensus Uncharacterized conserved protein [Funct 94.27
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 94.0
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 93.98
COG1743 875 Adenine-specific DNA methylase containing a Zn-rib 93.88
KOG0822 649 consensus Protein kinase inhibitor [Cell cycle con 93.74
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 93.57
PRK11524 284 putative methyltransferase; Provisional 93.33
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 93.33
COG1568354 Predicted methyltransferases [General function pre 93.3
KOG2198375 consensus tRNA cytosine-5-methylases and related e 93.11
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 93.06
TIGR00497 501 hsdM type I restriction system adenine methylase ( 92.85
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 92.81
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 92.71
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 92.21
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 92.06
COG4976287 Predicted methyltransferase (contains TPR repeat) 91.99
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 91.83
PRK13699227 putative methylase; Provisional 91.43
COG0863302 DNA modification methylase [DNA replication, recom 91.4
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 91.36
PF04378245 RsmJ: Ribosomal RNA small subunit methyltransferas 91.25
PTZ00357 1072 methyltransferase; Provisional 90.89
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 90.42
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 89.79
KOG3045325 consensus Predicted RNA methylase involved in rRNA 89.39
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 88.41
COG3129292 Predicted SAM-dependent methyltransferase [General 87.45
KOG3115249 consensus Methyltransferase-like protein [General 86.02
KOG2912 419 consensus Predicted DNA methylase [Function unknow 85.3
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 84.95
COG2961279 ComJ Protein involved in catabolism of external DN 84.39
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 83.94
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 82.18
COG3392 330 Adenine-specific DNA methylase [DNA replication, r 81.12
KOG0919 338 consensus C-5 cytosine-specific DNA methylase [Tra 80.67
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 80.04
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-51  Score=420.00  Aligned_cols=266  Identities=44%  Similarity=0.655  Sum_probs=226.5

Q ss_pred             cceEEEEEeeccccCCCCHHHHHHccCCCCCCCCceeEEECcEEEEEeCCCCcccHHHHHHHHHHhcCCCceEEEEcccc
Q 045638          162 ECFQLEVCNVDEAFDFHSYVQILEALLPKGMIIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDA  241 (437)
Q Consensus       162 ~~~elv~~~l~l~Y~~~~~~eIL~~iLP~~~~ipssfd~iGdIa~lnl~~e~~p~k~~I~evLl~k~~P~iktVv~K~~~  241 (437)
                      ..+++++++++|+|+||+++|||+++||++.+.|+||.++|||||+|+.++.+|++..||+++++|+ |.++||++|++.
T Consensus       115 ~~~~~i~~~~~L~yE~w~~keilRavlpe~e~~~s~ft~~GhIaHLNl~~e~lpfk~iI~~Vi~DK~-n~~ktvv~K~~~  193 (495)
T KOG2078|consen  115 PELEIIPHELELTYEYWKAKEILRAVLPEEEDVPSSFTITGHIAHLNLRDEQLPFKRIIGQVIYDKN-NLIKTVVNKIGR  193 (495)
T ss_pred             ccceeeccccccchhhhhHHHHHHhhCcccccccccceeeeeeEEeeccchhccHHHHHHHHhhccC-CCceEeeecccc
Confidence            3689999999999999999999999999998999999999999999999999999999999999999 999999999999


Q ss_pred             ccccccceeeeccce-------eeec--cc-----------------------c--cceEEeecCccchhHHHHhccCCE
Q 045638          242 IHNDYRTMQLEGDAY-------MCES--LF-----------------------F--VQMTGDVFAGVGPISIPAAKIVKR  287 (437)
Q Consensus       242 I~gefR~~~levLaG-------v~E~--~F-----------------------F--~e~VLDlFAGvG~FaI~aAkkg~~  287 (437)
                      |++.||++++++|||       ++|+  +|                       |  +++|+|+|||+|||++||++++|+
T Consensus       194 Itn~yR~~~~eviAGe~n~vtevre~~~~Fk~DfskVYWnsRL~~Eherlsg~fk~gevv~D~FaGvGPfa~Pa~kK~cr  273 (495)
T KOG2078|consen  194 ITNRYRNFKLEVIAGERNLVTEVREGGERFKFDFSKVYWNSRLSHEHERLSGLFKPGEVVCDVFAGVGPFALPAAKKGCR  273 (495)
T ss_pred             hhhhhcccCceEecCCCceEEEEecCCeeEEEecceEEeeccchhHHHHHhhccCCcchhhhhhcCcCccccchhhcCcE
Confidence            999999999999999       4555  44                       2  399999999999999999999999


Q ss_pred             EEEEeCCHHHHHHHHHHHHHcCCCCc-EEEEEccHHHHHHHH-------HHh-----------------hc--------C
Q 045638          288 VYANDLNPYAVDYLERNSVLNKLEKK-IEVFNMDGRRFIDAM-------FAS-----------------QK--------A  334 (437)
Q Consensus       288 V~A~DlNP~Ave~L~~NaklNkv~~~-V~vi~gDa~~~l~~~-------~~~-----------------~~--------~  334 (437)
                      |+|||+||+|++||+.|+++|+++.. |+++|+||.+|+++-       .+.                 +.        .
T Consensus       274 V~aNDLNpesik~Lk~ni~lNkv~~~~iei~Nmda~~Flr~e~~~~~~~I~~~v~~kl~k~~~t~~~~~d~~p~~~~~~~  353 (495)
T KOG2078|consen  274 VYANDLNPESIKWLKANIKLNKVDPSAIEIFNMDAKDFLRQEPLPYKRLIADEVLDKLMKKIGTVVNKIDRIPQPFRTMQ  353 (495)
T ss_pred             EEecCCCHHHHHHHHHhccccccchhheeeecccHHHHhhcCCchhhhHHHHHHhhhhhhhhcccccccccCCCcccccc
Confidence            99999999999999999999999865 999999999999521       000                 00        1


Q ss_pred             CcccEEEEcCCcChHHHHHHHHHHhcC-CCCCCCCCccEEEEEeccC---CCCCccc-HHHHHHHHHHhc---ccceeEE
Q 045638          335 HKITQVVMNLPNDATEFLDAFRGIYRD-RPEDVKFTFPKTHVYGFSK---ARDPEFD-FHERIRIALAEV---AVNVEMR  406 (437)
Q Consensus       335 ~~fD~VImnpP~~a~eFLdaa~~llk~-~~~~~~~~~p~IHvY~F~k---~~d~~~d-~~eRI~~~L~~~---~~~v~vr  406 (437)
                      ...+|++||+|.++.+||.+|...+.. ++.. +..+|+||||||++   ....-.+ +..|+...++-.   +..+.+|
T Consensus       354 ~~i~hvvmnLPa~avefL~~F~~~la~k~~~d-~~~lplvhcy~F~k~~~~~~s~e~~V~ar~~~~~kv~~e~~~~~~~h  432 (495)
T KOG2078|consen  354 LHIVHVVMNLPASAVEFLLRFSGDLARKGPID-KTPLPLVHCYCFSKLFCDVSSTEDLVTARIVAALKVFAEDGALVSLH  432 (495)
T ss_pred             hhhhhhhccChHHHHHHHHHhHHHHhccCccc-cccceeEEEEEEeecccCCCchHHHHHHHHHhhcceeeccccceeee
Confidence            125799999999999999999999987 3222 23578999999999   3322223 455554433222   2345899


Q ss_pred             EeEEecCCCcEEEEEEEEcccee
Q 045638          407 RVRLVAPGKWMLFASFVLPESVV  429 (437)
Q Consensus       407 ~VR~VAP~k~m~cisFrLp~~v~  429 (437)
                      .||+|||+|.|||++|++|..++
T Consensus       433 ~VR~VapnK~M~ca~~~lp~~~l  455 (495)
T KOG2078|consen  433 LVRKVAPNKEMYCASFQLPANVL  455 (495)
T ss_pred             eeeccCCCcccchhhhhcHHHHh
Confidence            99999999999999999999887

>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>KOG2912 consensus Predicted DNA methylase [Function unknown] Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG3392 Adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription] Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2zzn_A336 The Complex Structure Of Atrm5 And Trnacys Length = 4e-10
2zzm_A336 The Complex Structure Of Atrm5 And Trnaleu Length = 1e-09
2yx1_A336 Crystal Structure Of M.Jannaschii Trna M1g37 Methyl 3e-09
3a25_A301 Crystal Structure Of P. Horikoshii Tyw2 In Complex 3e-05
3k6r_A278 Crystal Structure Of Putative Transferase Ph0793 Fr 5e-04
>pdb|2ZZN|A Chain A, The Complex Structure Of Atrm5 And Trnacys Length = 336 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 78/155 (50%), Gaps = 25/155 (16%)
Query: 269 DVFAGVGPISIPAAKIVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAM 328
           D+FAGVGP SI A K  K++YA D+NP+A++ L++N  LNKLE KI     D R  +D  
Sbjct: 201 DMFAGVGPFSI-ACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVRE-VDV- 257
Query: 329 FASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDF 388
                  K  +V+MNLP  A +F+        D+  D+       H Y   K      DF
Sbjct: 258 -------KGNRVIMNLPKFAHKFI--------DKALDIVEEGGVIHYYTIGK------DF 296
Query: 389 HERIRIALAEVAVNV-EMRRVRLVAPGKWMLFASF 422
            + I++   +    V E R V+  AP +++L   F
Sbjct: 297 DKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDF 331
>pdb|2ZZM|A Chain A, The Complex Structure Of Atrm5 And Trnaleu Length = 336 Back     alignment and structure
>pdb|2YX1|A Chain A, Crystal Structure Of M.Jannaschii Trna M1g37 Methyltransferase Length = 336 Back     alignment and structure
>pdb|3A25|A Chain A, Crystal Structure Of P. Horikoshii Tyw2 In Complex With Adomet Length = 301 Back     alignment and structure
>pdb|3K6R|A Chain A, Crystal Structure Of Putative Transferase Ph0793 From Pyrococcus Horikoshii Length = 278 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2frn_A278 Hypothetical protein PH0793; structural genomics, 7e-47
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 2e-46
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 2e-46
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 2e-09
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 7e-09
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 3e-06
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 3e-06
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 6e-06
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 2e-05
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 5e-05
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 8e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
3ll7_A 410 Putative methyltransferase; methytransferase, stru 2e-04
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} SCOP: c.66.1.47 PDB: 3k6r_A 3a25_A* 3a26_A* Length = 278 Back     alignment and structure
 Score =  161 bits (409), Expect = 7e-47
 Identities = 62/285 (21%), Positives = 110/285 (38%), Gaps = 57/285 (20%)

Query: 182 QILEALLPKGMI--IPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKI 239
           +IL   LP+ ++  +P  +  +G +  L LR E +P+K+ IA+V  +     ++TV+ K 
Sbjct: 12  EILSKELPEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRIAEVYAEV--LGVKTVLRKG 69

Query: 240 DAIHNDYRTMQLEGDAY---------------------------------MCESLFFVQM 266
             IH + R    E                                     M +     ++
Sbjct: 70  H-IHGETRKPDYELLYGSDTVTVHVENGIKYKLDVAKIMFSPANVKERVRMAKVAKPDEL 128

Query: 267 TGDVFAGVGPISIPAAK-IVKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFI 325
             D+FAG+G +S+P A     +V A + +PY   +L  N  LNK+E ++  +NMD R F 
Sbjct: 129 VVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYTFKFLVENIHLNKVEDRMSAYNMDNRDFP 188

Query: 326 DAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPE 385
               A        +++M       EF+     I +D            H +     +   
Sbjct: 189 GENIA-------DRILMGYVVRTHEFIPKALSIAKDG--------AIIHYHNTVPEKLMP 233

Query: 386 FDFHERIRIALAEVAVNVE---MRRVRLVAPGKWMLFASFVLPES 427
            +  E  +    E   +VE     +++  APG W +     + +S
Sbjct: 234 REPFETFKRITKEYGYDVEKLNELKIKRYAPGVWHVVLDLRVFKS 278
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Length = 336 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Length = 272 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Length = 392 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Length = 378 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Length = 369 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Length = 425 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Length = 433 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Length = 410 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
3k6r_A278 Putative transferase PH0793; structural genomics, 100.0
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 100.0
2frn_A278 Hypothetical protein PH0793; structural genomics, 100.0
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.97
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.83
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.82
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.79
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.78
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.75
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.74
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.66
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.59
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.49
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.47
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.44
3lpm_A259 Putative methyltransferase; structural genomics, p 99.41
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.4
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.4
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.39
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.39
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.38
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.37
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.37
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.35
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.35
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.31
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.3
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.29
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.29
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.28
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.28
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.28
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.28
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 99.27
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.27
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.26
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.26
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.25
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.25
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.25
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.24
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.24
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.23
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.23
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.22
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.21
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.21
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.21
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.2
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.2
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.19
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.19
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.19
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.18
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.18
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.17
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.17
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.17
3ll7_A 410 Putative methyltransferase; methytransferase, stru 99.17
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.17
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.17
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.16
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.16
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.15
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.15
2h00_A254 Methyltransferase 10 domain containing protein; st 99.15
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.15
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.15
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.14
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.13
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.13
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.13
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.12
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.12
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.12
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.11
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.1
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.1
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.09
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.09
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.09
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.08
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.08
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.08
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.08
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.07
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.07
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.07
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.06
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.05
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 99.05
3lcc_A235 Putative methyl chloride transferase; halide methy 99.05
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.05
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.04
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.04
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.04
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.04
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.04
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.04
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.04
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.03
2o07_A304 Spermidine synthase; structural genomics, structur 99.02
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.02
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.02
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.01
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.0
2pt6_A321 Spermidine synthase; transferase, structural genom 99.0
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.99
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.99
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.99
3f4k_A257 Putative methyltransferase; structural genomics, P 98.98
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.98
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.97
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.97
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.97
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.96
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.96
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.96
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.96
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.94
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.94
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.94
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.94
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.94
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.93
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.92
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.92
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.92
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.92
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.92
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.91
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.91
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.91
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.9
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.89
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.89
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.88
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.88
2b25_A336 Hypothetical protein; structural genomics, methyl 98.88
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.88
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.88
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.87
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.87
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.87
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.86
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.86
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.86
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.86
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.85
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.85
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.85
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.85
3ocj_A305 Putative exported protein; structural genomics, PS 98.84
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.84
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.84
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.84
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.83
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.83
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.82
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.82
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.82
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.81
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.81
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.81
2i7c_A283 Spermidine synthase; transferase, structural genom 98.8
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.8
2oo3_A283 Protein involved in catabolism of external DNA; st 98.8
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.8
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.8
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.79
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.79
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.79
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.78
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.77
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.77
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.76
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.76
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.76
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.76
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.76
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.76
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.75
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.75
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.74
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.74
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.74
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.73
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.73
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.73
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.72
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.72
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.72
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.72
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.71
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.71
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.71
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.71
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.71
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.71
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.7
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.69
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.69
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.68
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.68
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.67
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.67
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.67
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.67
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.64
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.64
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.63
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.62
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.62
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.62
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.59
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.58
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.58
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.57
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.57
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.57
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.56
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.55
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.55
3lkd_A 542 Type I restriction-modification system methyltrans 98.54
3khk_A 544 Type I restriction-modification system methylation 98.54
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.52
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.5
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.49
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.48
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.47
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.47
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.47
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.47
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.46
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.46
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.46
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.45
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.45
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.44
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.44
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.41
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.39
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.38
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.38
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.37
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.37
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.37
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.36
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.36
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.36
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.35
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.34
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 98.3
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.27
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.27
3cc8_A230 Putative methyltransferase; structural genomics, j 98.26
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.25
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.18
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.17
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.16
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.15
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.12
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.09
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.08
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.08
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 98.08
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.08
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 98.07
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.04
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.0
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.98
3cvo_A202 Methyltransferase-like protein of unknown functio; 97.98
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.98
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 97.96
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 97.92
2zig_A297 TTHA0409, putative modification methylase; methylt 97.89
3ufb_A 530 Type I restriction-modification system methyltran 97.86
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 97.82
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 97.74
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 97.72
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 97.7
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.66
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 97.64
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.6
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.58
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.56
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.49
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.48
3me5_A 482 Cytosine-specific methyltransferase; structural ge 97.47
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.47
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 97.43
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.33
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.28
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.22
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.21
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 97.18
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.17
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 97.12
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 97.03
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 97.03
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 96.94
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 96.91
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 96.61
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 96.41
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 96.37
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 95.66
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 94.67
4dkj_A 403 Cytosine-specific methyltransferase; CG-specificit 94.45
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 93.11
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 89.49
2px2_A269 Genome polyprotein [contains: capsid protein C (co 89.16
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 89.1
2zig_A 297 TTHA0409, putative modification methylase; methylt 88.64
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 87.84
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 86.13
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 85.59
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 85.5
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 84.43
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 84.26
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 83.07
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 82.68
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 82.23
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 82.12
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 81.72
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 81.42
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 81.2
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 81.19
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 81.1
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 80.89
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 80.69
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 80.41
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 80.19
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 80.01
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-48  Score=383.97  Aligned_cols=231  Identities=26%  Similarity=0.405  Sum_probs=193.7

Q ss_pred             CHHHHHHccCCCCC--CCCceeEEECcEEEEEeCCCCcccHHHHHHHHHHhcCCCceEEEEccccccccccceeeeccce
Q 045638          179 SYVQILEALLPKGM--IIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAY  256 (437)
Q Consensus       179 ~~~eIL~~iLP~~~--~ipssfd~iGdIa~lnl~~e~~p~k~~I~evLl~k~~P~iktVv~K~~~I~gefR~~~levLaG  256 (437)
                      +++|+|++.||+++  .+|+|||++|||||++++++++||++.|+++++++.  ++++|+++ +.+.|+||++++++|+|
T Consensus         9 ~~~e~l~~~lp~~l~~~~P~~~e~~Gdi~il~~~~~~~~~~~~i~~~l~~~~--~vk~V~~k-~~i~g~~R~~~~e~L~G   85 (278)
T 3k6r_A            9 RIREILSKELPEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRIAEVYAEVL--GVKTVLRK-GHIHGETRKPDYELLYG   85 (278)
T ss_dssp             HHHHHHTTTSCGGGGGGSCSCCEEETTEEEECC-CTTGGGHHHHHHHHHHHH--TCSEEEEC-C----------CEEEEC
T ss_pred             HHHHHHhhhCChhHHhhCCCCceEECCEEEEeCChhHhHHHHHHHHHHHhcc--CCeEEEEe-CCcCCccccccceEEec
Confidence            46899999999987  599999999999999999999999999999999975  79999998 66899999999999999


Q ss_pred             ------eeec--cc--------c-----------------cceEEeecCccchhHHHHhccCC-EEEEEeCCHHHHHHHH
Q 045638          257 ------MCES--LF--------F-----------------VQMTGDVFAGVGPISIPAAKIVK-RVYANDLNPYAVDYLE  302 (437)
Q Consensus       257 ------v~E~--~F--------F-----------------~e~VLDlFAGvG~FaI~aAkkg~-~V~A~DlNP~Ave~L~  302 (437)
                            ++||  .|        |                 +++|||+|||+|+||+++|++|+ +|+|+|+||+|+++++
T Consensus        86 ~~~~~~~~E~G~~~~~D~~k~~f~~~~~~er~ri~~~~~~g~~VlD~~aG~G~~~i~~a~~g~~~V~avD~np~a~~~~~  165 (278)
T 3k6r_A           86 SDTVTVHVENGIKYKLDVAKIMFSPANVKERVRMAKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYTFKFLV  165 (278)
T ss_dssp             SCCEEEEEETTEEEEEETTTSCCCGGGHHHHHHHHHHCCTTCEEEETTCTTTTTTHHHHHHTCCEEEEECCCHHHHHHHH
T ss_pred             CCcEEEEEECCEEEEEeccceEEcCCcHHHHHHHHHhcCCCCEEEEecCcCcHHHHHHHHhcCCeEEEEECCHHHHHHHH
Confidence                  6788  33        2                 28999999999999999999985 9999999999999999


Q ss_pred             HHHHHcCCCCcEEEEEccHHHHHHHHHHhhcCCcccEEEEcCCcChHHHHHHHHHHhcCCCCCCCCCccEEEEEeccCCC
Q 045638          303 RNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKAR  382 (437)
Q Consensus       303 ~NaklNkv~~~V~vi~gDa~~~l~~~~~~~~~~~fD~VImnpP~~a~eFLdaa~~llk~~~~~~~~~~p~IHvY~F~k~~  382 (437)
                      +|+++|+++++++++++|++++..       ...||+|+||||.++.+||+.+.++++++        |+||+|+|++++
T Consensus       166 ~N~~~N~v~~~v~~~~~D~~~~~~-------~~~~D~Vi~~~p~~~~~~l~~a~~~lk~g--------G~ih~~~~~~e~  230 (278)
T 3k6r_A          166 ENIHLNKVEDRMSAYNMDNRDFPG-------ENIADRILMGYVVRTHEFIPKALSIAKDG--------AIIHYHNTVPEK  230 (278)
T ss_dssp             HHHHHTTCTTTEEEECSCTTTCCC-------CSCEEEEEECCCSSGGGGHHHHHHHEEEE--------EEEEEEEEEEGG
T ss_pred             HHHHHcCCCCcEEEEeCcHHHhcc-------ccCCCEEEECCCCcHHHHHHHHHHHcCCC--------CEEEEEeeeccc
Confidence            999999999999999999998853       46799999999999999999999999986        799999999876


Q ss_pred             CCcccHHHHHHHHHHhcc---cceeEEEeEEecCCCcEEEEEEEEccc
Q 045638          383 DPEFDFHERIRIALAEVA---VNVEMRRVRLVAPGKWMLFASFVLPES  427 (437)
Q Consensus       383 d~~~d~~eRI~~~L~~~~---~~v~vr~VR~VAP~k~m~cisFrLp~~  427 (437)
                      +...+..+.+.+.+.+.+   ..++++.||+|||++||+|+||+++++
T Consensus       231 ~~~~~~~e~i~~~~~~~g~~v~~~~~~~Vk~yaP~~~hvv~D~~i~ks  278 (278)
T 3k6r_A          231 LMPREPFETFKRITKEYGYDVEKLNELKIKRYAPGVWHVVLDLRVFKS  278 (278)
T ss_dssp             GTTTTTHHHHHHHHHHTTCEEEEEEEEEEEEETTTEEEEEEEEEEECC
T ss_pred             ccchhHHHHHHHHHHHcCCcEEEEEEEEEEeECcCccEEEEEEEEeCC
Confidence            544445556655544433   345789999999999999999999864
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d2frna1260 c.66.1.47 (A:19-278) Hypothetical protein PH0793 { 1e-31
d2dula1 375 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tR 8e-06
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Met-10+ protein-like
domain: Hypothetical protein PH0793
species: Pyrococcus horikoshii [TaxId: 53953]

 Score =  119 bits (298), Expect = 1e-31
 Identities = 58/271 (21%), Positives = 101/271 (37%), Gaps = 55/271 (20%)

Query: 194 IPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEG 253
           +P  +  +G +  L LR E +P+K+ IA+V  +    K  TV+ K   IH + R    E 
Sbjct: 8   LPKRWVRIGDVLLLPLRPELEPYKHRIAEVYAEVLGVK--TVLRKGH-IHGETRKPDYEL 64

Query: 254 DA-----------------YMCESLFFVQMTG----------------DVFAGVGPISIP 280
                               + + +F                      D+FAG+G +S+P
Sbjct: 65  LYGSDTVTVHVENGIKYKLDVAKIMFSPANVKERVRMAKVAKPDELVVDMFAGIGHLSLP 124

Query: 281 AAKI-VKRVYANDLNPYAVDYLERNSVLNKLEKKIEVFNMDGRRFIDAMFASQKAHKITQ 339
            A     +V A + +PY   +L  N  LNK+E ++  +NMD R F          +   +
Sbjct: 125 IAVYGKAKVIAIEKDPYTFKFLVENIHLNKVEDRMSAYNMDNRDF-------PGENIADR 177

Query: 340 VVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERIRIALAEV 399
           ++M       EF+     I +D            H +     +    +  E  +    E 
Sbjct: 178 ILMGYVVRTHEFIPKALSIAKDG--------AIIHYHNTVPEKLMPREPFETFKRITKEY 229

Query: 400 AVNVE---MRRVRLVAPGKWMLFASFVLPES 427
             +VE     +++  APG W +     + +S
Sbjct: 230 GYDVEKLNELKIKRYAPGVWHVVLDLRVFKS 260
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Length = 375 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 100.0
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.86
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.83
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.82
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.69
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.68
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.67
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.64
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.61
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.59
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.55
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.52
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.46
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.44
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.41
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.32
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.31
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.24
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.22
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.2
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.19
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.15
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.13
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.12
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.11
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.08
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.07
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.07
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.06
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.05
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.01
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.0
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.99
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.98
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.96
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.95
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.94
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.92
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.9
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.9
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.9
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.87
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.84
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.82
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.81
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.79
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.78
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.77
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.75
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.74
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.73
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.72
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.71
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.7
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.63
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.62
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.61
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.57
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.54
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 98.51
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.47
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.46
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.45
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.43
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.42
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.41
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.4
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.38
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.32
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.32
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.31
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.26
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.22
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.2
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.14
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.07
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.02
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.0
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.99
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.96
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.95
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.94
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.9
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 97.86
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.86
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.84
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.81
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.8
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.79
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.78
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.77
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 97.73
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 97.55
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 97.46
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 97.14
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 97.09
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.03
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 96.97
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 96.79
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 96.67
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 96.5
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.3
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 96.03
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.01
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 95.41
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.97
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 94.71
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.21
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.11
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.87
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.55
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 92.0
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.88
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 91.5
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 91.06
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 90.46
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 89.86
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.81
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 89.76
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 89.21
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 88.81
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 88.75
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 87.73
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 86.34
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 86.17
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 85.74
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 85.43
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 85.36
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 85.04
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 85.01
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 84.88
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 84.03
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 82.09
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 81.44
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 81.18
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 80.58
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 80.02
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Met-10+ protein-like
domain: Hypothetical protein PH0793
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=1.6e-42  Score=335.08  Aligned_cols=221  Identities=26%  Similarity=0.411  Sum_probs=178.6

Q ss_pred             CCCC--CCCceeEEECcEEEEEeCCCCcccHHHHHHHHHHhcCCCceEEEEccccccccccceeeeccce------eeec
Q 045638          189 PKGM--IIPSAFETVGHIAHLNLREEHQPFKYLIAKVVLDKNKPKIQTVVNKIDAIHNDYRTMQLEGDAY------MCES  260 (437)
Q Consensus       189 P~~~--~ipssfd~iGdIa~lnl~~e~~p~k~~I~evLl~k~~P~iktVv~K~~~I~gefR~~~levLaG------v~E~  260 (437)
                      |+++  .+|++||++||||++++++++.++++.|++++++..  ++++|+.+ +.++|++|.+++++|+|      ++|+
T Consensus         1 p~~l~~~lP~~~e~~Gdi~ii~~~~~~~~~~~~i~~~l~~~~--~~k~v~~k-~~i~g~~R~~~~~~l~G~~~~~~~~E~   77 (260)
T d2frna1           1 PEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRIAEVYAEVL--GVKTVLRK-GHIHGETRKPDYELLYGSDTVTVHVEN   77 (260)
T ss_dssp             CCCTTTCSCSCCEEETTEEECC--CCSCSCCTHHHHHHHHHH--TCSEEEEC-C----------CEEEECSCCEEEEEET
T ss_pred             ChhhhhhCCCCeEEECCEEEEECCCchhHHHHHHHHHHHhhc--CCeEEEEc-CCccchhccccceecCCCCceeEEEec
Confidence            6666  599999999999999999999999999999999975  69999988 66889999999999999      5677


Q ss_pred             --cc--------c-----------------cceEEeecCccchhHHHHhccCC-EEEEEeCCHHHHHHHHHHHHHcCCCC
Q 045638          261 --LF--------F-----------------VQMTGDVFAGVGPISIPAAKIVK-RVYANDLNPYAVDYLERNSVLNKLEK  312 (437)
Q Consensus       261 --~F--------F-----------------~e~VLDlFAGvG~FaI~aAkkg~-~V~A~DlNP~Ave~L~~NaklNkv~~  312 (437)
                        .|        |                 +++|||+|||+|+||+++|++|+ +|+|+|+||+|++++++|+++|++++
T Consensus        78 g~~~~~d~~~~~f~~~~~~er~ri~~~~~~g~~VlD~~aG~G~~~l~~a~~~~~~V~avd~n~~a~~~~~~N~~~n~l~~  157 (260)
T d2frna1          78 GIKYKLDVAKIMFSPANVKERVRMAKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYTFKFLVENIHLNKVED  157 (260)
T ss_dssp             TEEEEEETTTSCCCGGGHHHHHHHHHHCCTTCEEEETTCTTTTTHHHHHHHTCCEEEEECCCHHHHHHHHHHHHHTTCTT
T ss_pred             CeeEEeccccccEecCCHHHHHHHHhhcCCccEEEECcceEcHHHHHHHHhCCcEEEEecCCHHHHHHHHHHHHHhCCCc
Confidence              33        2                 28999999999999999999874 99999999999999999999999998


Q ss_pred             cEEEEEccHHHHHHHHHHhhcCCcccEEEEcCCcChHHHHHHHHHHhcCCCCCCCCCccEEEEEeccCCCCCcccHHHHH
Q 045638          313 KIEVFNMDGRRFIDAMFASQKAHKITQVVMNLPNDATEFLDAFRGIYRDRPEDVKFTFPKTHVYGFSKARDPEFDFHERI  392 (437)
Q Consensus       313 ~V~vi~gDa~~~l~~~~~~~~~~~fD~VImnpP~~a~eFLdaa~~llk~~~~~~~~~~p~IHvY~F~k~~d~~~d~~eRI  392 (437)
                      +++++++|++++..       ...||+|+||||..+.+||+.+.++++++        |+||+|+|+++.....+..+.+
T Consensus       158 ~v~~~~~D~~~~~~-------~~~~D~Ii~~~p~~~~~~l~~a~~~l~~g--------G~lh~~~~~~~~~~~~~~~e~~  222 (260)
T d2frna1         158 RMSAYNMDNRDFPG-------ENIADRILMGYVVRTHEFIPKALSIAKDG--------AIIHYHNTVPEKLMPREPFETF  222 (260)
T ss_dssp             TEEEECSCTTTCCC-------CSCEEEEEECCCSSGGGGHHHHHHHEEEE--------EEEEEEEEEEGGGTTTTTHHHH
T ss_pred             eEEEEEcchHHhcc-------CCCCCEEEECCCCchHHHHHHHHhhcCCC--------CEEEEEeccccccchhhHHHHH
Confidence            99999999998753       46799999999999999999999999987        7999999987654333334444


Q ss_pred             HHHHHhc---ccceeEEEeEEecCCCcEEEEEEEEccc
Q 045638          393 RIALAEV---AVNVEMRRVRLVAPGKWMLFASFVLPES  427 (437)
Q Consensus       393 ~~~L~~~---~~~v~vr~VR~VAP~k~m~cisFrLp~~  427 (437)
                      .+.+...   ...++.+.||+|||+++|+|+|+++.++
T Consensus       223 ~~~~~~~g~~v~~~~~~~Vk~yaP~~~~v~~D~~i~~~  260 (260)
T d2frna1         223 KRITKEYGYDVEKLNELKIKRYAPGVWHVVLDLRVFKS  260 (260)
T ss_dssp             HHHHHHTTCEEEEEEEEEEEEETTTEEEEEEEEEEECC
T ss_pred             HHHHHHcCCceEEEEEEEEECcCCCccEEEEEEEEeCC
Confidence            4433332   2345788999999999999999999763
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure