Citrus Sinensis ID: 045642

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------

MPDIQALVSDLPSKLRKRRVQGSYETARLTAELLRAVILQHKEPTASGAASLIEAVRRVGEQLIAANPVELAVGNIVRHVLHIIREEDLSPLTDIVGELKLSAEDDVEDIAEDENSQKSSATTDGCLLKPPLLLAVFEHLPDSAPACQTFSSENIFAGKADKSAKKLKSELIKAVNELIEDINTCREGIAEQAMELIHQNEVILTLGHSKFVKEFLCAAKEKKRSFEVFIADGAPKFEGHILAKELDKKGLKAIVITDSAVFAMISRVNMVIVGVHAVMANGGVIAPAGLHVLALAAKKHDVPFVVVASTHELCSLYPHNLEVLLNEMRCPSELLNFEEFSDCIDYGIASSSSLLHVVNPAFDYVPPELIRLFVTDIGGYSPSYIYRLIADYYSSEDLPPQQKPAS

cccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccHHHHcccccHHHHHHHHccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHccccEEEEcHHHHHHHcccccEEEEcccEEEcccccccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEccccccccHHHHHHHHHcccccccccccccc

**DIQALVSDLPSKLRKRRVQGSYETARLTAELLRAVILQHKEPTASGAASLIEAVRRVGEQLIAANPVELAVGNIVRHVLHIIREEDLSPLTDIVG**KLSA***********************LLKPPLLLAVFEHLPDSAPACQTFSSENIFA*********LKSELIKAVNELIEDINTCREGIAEQAMELIHQNEVILTLGHSKFVKEFLCAAKEKKRSFEVFIADGAPKFEGHILAKELDKKGLKAIVITDSAVFAMISRVNMVIVGVHAVMANGGVIAPAGLHVLALAAKKHDVPFVVVASTHELCSLYPHNLEVLLNEMRCPSELLNFEEFSDCIDYGIASSSSLLHVVNPAFDYVPPELIRLFVTDIGGYSPSYIYRLIADYYSSEDL*P******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Translation initiation factor eIF-2B subunit beta	Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.	probable	Q5E9B4
Translation initiation factor eIF-2B subunit beta	Acts as a regulatory component of the translation initiation factor 2B (eIF2-B or GCD complex), which catalyzes the exchange of eukaryotic initiation factor 2 (eIF-2)-bound GDP for GTP and is regulated by phosphorylated eIF-2. It activates the synthesis of GCN4 in yeast under amino acid starvation conditions by suppressing the inhibitory effects of multiple AUG codons present in the leader of GCN4 mRNA. It may promote either repression or activation of GCN4 expression depending on amino acid availability. GCD6 and GCD7 repress GCN4 expression at the translational level by ensuring that ribosomes which have translated UORF1 will reinitiate at UORF2, -3, or -4 and thus fail to reach the GCN4 start site.	probable	P32502
Translation initiation factor eIF-2B subunit beta	Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.	probable	Q62818

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A11, chain A
Confidence level:very confident
Coverage over the Query: 6-90,161-398
View the alignment between query and template
View the model in PyMOL