Citrus Sinensis ID: 045686


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-----
MEILINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREARRDLENITRDVEARVDLAVEQRSRPRHEVNGWLESAQFMLREVDGILQRGDEEIQKTCLRKTCFPGTWCSRDKLGKEASEKIVAVEELIGRGHFAVIAERPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFRDTGHDFDLVIWVKVSRDANLEKIQESILRRFEIPDQMWIGKDEDGRANEILSNLRGKKFVLLLDDVWERLDLSKVGVSDLLDDSSQTGSKIVFTTRSEEVCGEMGARRRFRVECLSPEAALDLFRYKVGEDVYSSHFEISNLAQTVVEECRGLPLALVTIGHAMASRMGPTQWRYAVGELQRYPFKFAGMGNSVFPILRFSYDSLREDIFKTCFLYCALFPEEHNITKDELIQLWIGEGFLNGISPRDQGEYIIESLKLACLLERGENSEDSVKMHNLIRDMALELASENDNKTLVLQNNVGSNIESINSFDGWHEAVRLSLWGSSIDFLALVEAPSCPQVRTLLARLTMLHTLPIPSRFFDSMDALEVLDLSYNLDLNQLPEEIGRLKNLHHLNLSNTSIGCLPTAIKRLIKLKVLLLDGIQCHLSIPEGVISSLSSLQVFSCFSTELVELIDPLFNETAILDELNCLEHLNDLSLTLFSTEAVDKLLNSPKLQRCIRRLTIESSELLSLELGLMLSHLEILRIKCGFMKRLNIDQGLNNRPSFSALRRLSIILCPDIQNLTCLVHVPSLQFLSLSNCHSLEEIVGTYASGSSESRNYFSNLMAVDLDGLPTLRSICSGTVAFPSLQTLSITGCPSLKKLPFNSESARRSLISVRASAEWWNQLEWEDEATKDIFTVKFQEMNVKR
ccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHcccccccccccEEEEEEEcccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccEEEEEcccHHHHHHccccccEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccHHHHcccccccccccHHHHHHHccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccCCcccccEEEEccHHHHHHHHHHccccccEEEEcccccccccccccccccEEEEEEEEEcccccccccccccccccccEEEcccccccccccccHHHcccccccEEEcccccccccccccccccccccEEcccccccccccHHHHccccccEEcccccccccccccccccccccccEEcccccccccccccccccccccHHHccccccccEEEEEccHHHHHHHHccccccccccccEEccccccHHHcccccccccEEEEEEcccccCECcccccccccccccEEEEECccccccccccccccccccEEEECcccccEEEcccccccccccccccccccEEEccccccccCCcccccccccccEEEECcccccccccccccccccccEEEEccHHHHcccccccccHHHHcccccEEEcccc
MEILINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREARRDLENITRDVEARVDLA********HEVNGWLESAQFMLREVDGILQRGDEEIQKTCLRKTCFPGTWCSRDKLGKEASEKIVAVEELIGRG****************RPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFRDTGHDFDLVIWVKVSRDANLEKIQESILRRFEIPDQMWIGKDEDGRANEILSNLRGKKFVLLLDDVWERLDLSKVGVSDLLDDSSQTGSKIVFTTRSEEVCGEMGARRRFRVECLSPEAALDLFRYKVGEDVYSSHFEISNLAQTVVEECRGLPLALVTIGHAMASRMGPTQWRYAVGELQRYPFKFAGMGNSVFPILRFSYDSLREDIFKTCFLYCALFPEEHNITKDELIQLWIGEGFLNGISPRDQGEYIIESLKLACLLERGENSEDSVKMHNLIRDMALELASENDNKTLVLQNNVGSNIESINSFDGWHEAVRLSLWGSSIDFLALVEAPSCPQVRTLLARLTMLHTLPIPSRFFDSMDALEVLDLSYNLDLNQLPEEIGRLKNLHHLNLSNTSIGCLPTAIKRLIKLKVLLLDGIQCHLSIPEGVISSLSSLQVFSCFSTELVELIDPLFNETAILDELNCLEHLNDLSLTLFSTEAVDKLLNSPKLQRCIRRLTIESSELLSLELGLMLSHLEILRIKCGFMKRLNIDQGLNNRPSFSALRRLSIILCPDIQNLTCLVHVPSLQFLSLSNCHSLEEIVGTYASGSSESRNYFSNLMAVDLDGLPTLRSICSGTVAFPSLQTLSITGCPSLKKLPFNS***RRSLISVRASAEWWNQLEWEDEATKDIFTVKFQEM****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEILINPIMDYLVCPLCGVISKHCGYVCGxxxxxxxxxxxxxxxxxxxxxxxxxVDLAVEQRSRPRHEVNGWLESAQFMLREVDGILQRGDEEIQKTCLRKTCFPGTWCSRDKLGKEASEKIVAVEELIGRGHFAVIAERPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFRDTGHDFDLVIWVKVSRDANLEKIQESILRRFEIPDQMWIGKDEDGRANEILSNLRGKKFVLLLDDVWERLDLSKVGVSDLLDDSSQTGSKIVFTTRSEEVCGEMGARRRFRVECLSPEAALDLFRYKVGEDVYSSHFEISNLAQTVVEECRGLPLALVTIGHAMASRMGPTQWRYAVGELQRYPFKFAGMGNSVFPILRFSYDSLREDIFKTCFLYCALFPEEHNITKDELIQLWIGEGFLNGISPRDQGEYIIESLKLACLLERGENSEDSVKMHNLIRDMALELASENDNKTLVLQNNVGSNIESINSFDGWHEAVRLSLWGSSIDFLALVEAPSCPQVRTLLARLTMLHTLPIPSRFFDSMDALEVLDLSYNLDLNQLPEEIGRLKNLHHLNLSNTSIGCLPTAIKRLIKLKVLLLDGIQCHLSIPEGVISSLSSLQVFSCFSTELVELIDPLFNETAILDELNCLEHLNDLSLTLFSTEAVDKLLNSPKLQRCIRRLTIESSELLSLELGLMLSHLEILRIKCGFMKRLNIDQGLNNRPSFSALRRLSIILCPDIQNLTCLVHVPSLQFLSLSNCHSLEEIVGTYASGSSESRNYFSNLMAVDLDGLPTLRSICSGTVAFPSLQTLSITGCPSLKKLPFNSESARRSLISVRASAEWWNQLEWEDEATKDIFTVKFQEMNVKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable disease resistance protein At5g63020 Probable disease resistance protein.probableQ8RXS5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 508-842
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 510-856
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 510-866
View the alignment between query and template
View the model in PyMOL
Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 149-273,284-487
View the alignment between query and template
View the model in PyMOL
Template: 1W5S, chain A
Confidence level:confident
Coverage over the Query: 152-378,397-477
View the alignment between query and template
View the model in PyMOL
Template: 3QFL, chain A
Confidence level:confident
Coverage over the Query: 11-95
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 554-850
View the alignment between query and template
View the model in PyMOL