Citrus Sinensis ID: 045783

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MRRARGAATTTAATKQLIEPNGSAARNAAAAGKEPRYRGVRKRPWGRFAAEIRDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPIHNTNVSSYYPNNNNDPFLDQRLYGSVFHDIQDQQIVNPQRPTTSSMSSTVESFSGPRPPHPPQRSANLTDGSRRYPRTPPVVPEDCHSDCDSSSSVIDDDGDIALSSCRKSLLPFDLNFPPLDDVDFNGDDDLQCTALCL
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccEEEcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***************************************VRKRPWGRFAAEIRDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPIHNTNV*************************************************************************************************IALSSCRKSLLPFDLNFPPLDDVDFNGDDDLQCTALCL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRARGAATTTAATKQLIEPNGSAARNAAAAGKEPRYRGVRKRPWGRFAAEIRDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPIHNTNVSSYYPNNNNDPFLDQRLYGSVFHDIQDQQIVNPQRPTTSSMSSTVESFSGPRPPHPPQRSANLTDGSRRYPRTPPVVPEDCHSDCDSSSSVIDDDGDIALSSCRKSLLPFDLNFPPLDDVDFNGDDDLQCTALCL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ethylene-responsive transcription factor 7 Involved in the regulation of gene expression by abscisic acid, stress factors and by components of stress signal transduction pathways. Transcription factor that binds to the GCC-box pathogenesis-related promoter element. Part of a transcriptional repressor complex including a histone deacetylase.probableQ9LDE4
Ethylene-responsive transcription factor 3 Transcription factor that binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. Probably acts as a transcriptional repressor and may regulate other AtERFs.probableQ9SXS8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 36-95
View the alignment between query and template
View the model in PyMOL