Citrus Sinensis ID: 045786


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---
MPSFDSQFSNSEKLVTFSCTEGTTIQSNRGSNLGAFEQSVGFRLGDAVNLTGNTVLNSTKASGQANTSDPLQIVTFDKSPTASNFNLSTIQVESHRLPFEKNHRSNLVSISSGNTENWGESNMADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAFDVEYARWLEEQNKQINELRSAVNSHASDTELRMVVDGIMAHYDEIFRLKANAAKADVFHLLSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWMARPRE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHcccc
********************************LGAFEQSVGFRLGDAVNLTGNTVL*******************************************************************************************************************************************************************************NGAMAFDVEYARWLEEQNKQINELRS********TELRMVVDGIMAHYDEIFRLKANAAKADVFHLLSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQ*************MEALQQSLAETLS******************MAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWMAR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSFDSQFSNSEKLVTFSCTEGTTIQSNRGSNLGAFEQSVGFRLGDAVNLTGNTVLNSTKASGQANTSDPLQIVTFDKSPTASNFNLSTIQVESHRLPFEKNHRSNLVSISSGNTENWGESNMADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIFISSSGDQAHSMSGNGAMAFDVEYARWxxxxxxxxxxxxxxxxxxxxxTELRMVVDGIMAHYDEIFRLKANAAKADVFHLLSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQGMEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWMARPRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor TGA6 Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.probableQ39140
Transcription factor HBP-1b(c1) (Fragment) Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.probableQ41558
Transcription factor HBP-1b(c38) Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.probableP23923

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GU4, chain A
Confidence level:confident
Coverage over the Query: 164-214
View the alignment between query and template
View the model in PyMOL
Template: 2Y39, chain A
Confidence level:probable
Coverage over the Query: 319-373,384-436
View the alignment between query and template
View the model in PyMOL