Citrus Sinensis ID: 045794

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MDNTRSLSSISSTSSLLFTRTNEFYKIQNRVKFKSPRALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI
cccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEEcccccHHHHHHHHHHcccEEEEccccHHHccccEEEccccccHHHHHHHHHHcccHHHHHHHHHccccEEEEHHHHHHHccccccccccccccCCccccccccccccccccccccccccccccccccccccccEEEEEEEEECcccccccccEEEccccccHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccEEEEccccccccccccccccccccHHHHHHHHHHccccEEEEEECcccccccccccHHHHHHHHHHHccEEEEECccccccccccccccccHHHHHHHHHHccccccccccHHHHcHHHHHHcccccccHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEcccccccccccEEEEEEccccccccccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHcccccEEccccccccccHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHccccccc
******************TRTNEFYKIQNR******RALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKT***********LKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNTRSLSSISSTSSLLFTRTNEFYKIQNRVKFKSPRALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Imidazole glycerol phosphate synthase hisHF, chloroplastic IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The glutamine amidotransferase domain provides the ammonia necessary to the cyclase domain to produce IGP and AICAR from PRFAR.confidentQ9SZ30
Imidazole glycerol phosphate synthase hisHF IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The glutamine amidotransferase domain provides the ammonia necessary to the cyclase domain to produce IGP and AICAR from PRFAR.probableQ9P4P9
Imidazole glycerol phosphate synthase hisHF IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The glutamine amidotransferase domain provides the ammonia necessary to the cyclase domain to produce IGP and AICAR from PRFAR.probableP33734

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JVN, chain A
Confidence level:very confident
Coverage over the Query: 47-290,306-578
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 34-44
View the alignment between query and template
View the model in PyMOL