Citrus Sinensis ID: 045794

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MDNTRSLSSISSTSSLLFTRTNEFYKIQNRVKFKSPRALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI
cccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEEcccccHHHHHHHHHHcccEEEEcccHHHHHcccEEEccccccHHHHHHHHHHcccHHHHHHHHHccccEEEEHHHHHHHccccccccccccccEEccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccccccEEEccccccHHHHHHccccEEEEEccccccHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccEEEEccccccccccccccccccccHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHccEEEEEEccccccccccccccccHHHHHHHHHHcccccccccHHHHHcHHHHHHcccccccHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEcccccccccccEEEEEEccccccccccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHcccccEEccccccccccHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHccccccc
ccccccccHHccHcHHHHcccccHHHEHcccccccccccEEEEcccccEEEEEccccccHHHHHHHHHHcccEEEEEccccccccccEEEEcccccHHHHHHcccccccHHHHHHHHHccccEEEccHHHHccccEEccccccccccccccEEEEccccccccccEEEEEEcEccccccHHccccccEEEEEEEEEccccccccccEEEEEcccHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHccccccccccccccccHcccEEEEEEEEEccccccEEEEEcccEEEEEccccccHHEEEcHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHccEEEEEcccccEEccccccccccHHHHHHHHHHccccEEEEccHHHHcHHHHHHcccccccHHHHHHHHHHcccEEEEEEcccEEEcccccccccEEEEEccccccccccEcEEEEEccccEEEEEEHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEcHHHHHcccccHHHHHHHHHHcccEEcc
mdntrslssisstssllftrTNEFYKIQNrvkfkspralsiratssDSVVTLLDYGAGNVRSVRNAIRHLgfgikdvqtpedilnanrlifpgVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFqsseengpvnglglipgvvgrfdssngfrvpqigwnalqitkdseilddvgdhHVYFVhsyrampsddnkewvsstcnygdnfiasvrrgnvhavqfhpeksgdvgLSVLRRflhpktnipkkptegKALKLAKRVIACLDvrandkgdlvvtkgdqydvrehtkenevrnlgkpVELARQYYKEGADEisflnitgfrdfplgdlpmlqvlrltsenvfvpltvgggirdftdangrhysslEVASEYfrsgadkisigsdAVYAAEDYLKTGVKTGKSSLEQISRVYgnqavvvsidprrvyithpndvefkavrvtdlgpngeeyAWYQCTvnggregrpiGAYELAKAVEDLGAGEILLncidcdgqgkgfdMDLIKLISDAvsipviassgagavehFSDVFRKTNASAALAAGIfhrkevpiqSVKEHLYKEGIEVRI
mdntrslssisstssllftrtNEFYKiqnrvkfkspralsiratssdsvvTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSyrampsddnKEWVSSTCNYGDNFIASVRRGNVHAVQFhpeksgdvglSVLRRFLhpktnipkkptegkalKLAKRVIACLdvrandkgdlvvtkgdqydvrehtkenevrnlgkpvELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRvygnqavvvsidprrvyithpndvefkAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIfhrkevpiqsvkehlykegievri
MDNTRslssisstssllFTRTNEFYKIQNRVKFKSPRALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI
******************TRTNEFYKIQNRVKFKSPRALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNI******GKALKLAKRVIACLDVRANDKGDLVVTKGDQYDVR*******VRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLY********
*********************************************SDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFL*****************LAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI
*************SSLLFTRTNEFYKIQNRVKFKSPRALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI
**************SLLFTRTNEFYKIQNR******RALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKT***********LKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNTRSLSSISSTSSLLFTRTNEFYKIQNRVKFKSPRALSIRATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query578 2.2.26 [Sep-21-2011]
Q9SZ30592 Imidazole glycerol phosph yes no 0.946 0.923 0.848 0.0
O94303541 Imidazole glycerol phosph yes no 0.906 0.968 0.518 1e-156
Q9P4P9553 Imidazole glycerol phosph yes no 0.904 0.945 0.504 1e-150
P33734552 Imidazole glycerol phosph yes no 0.913 0.956 0.506 1e-149
A6UR05272 Imidazole glycerol phosph yes no 0.468 0.996 0.396 4e-50
A5UMZ1274 Imidazole glycerol phosph yes no 0.472 0.996 0.405 8e-50
A4G0J7272 Imidazole glycerol phosph yes no 0.465 0.988 0.387 2e-48
O27398274 Imidazole glycerol phosph yes no 0.472 0.996 0.392 4e-48
A6VHY8272 Imidazole glycerol phosph yes no 0.463 0.985 0.378 7e-48
Q2NI84274 Imidazole glycerol phosph yes no 0.472 0.996 0.399 8e-48
>sp|Q9SZ30|HIS5_ARATH Imidazole glycerol phosphate synthase hisHF, chloroplastic OS=Arabidopsis thaliana GN=At4g26900 PE=1 SV=1 Back     alignment and function desciption
 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/548 (84%), Positives = 513/548 (93%), Gaps = 1/548 (0%)

Query: 32  KFKSPRALSIRATS-SDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLI 90
           KFKSPR+LS+RA+S SDSVVTLLDYGAGNVRS+RNA+RHLGF IKDVQTP DILNA+RLI
Sbjct: 45  KFKSPRSLSVRASSTSDSVVTLLDYGAGNVRSIRNALRHLGFSIKDVQTPGDILNADRLI 104

Query: 91  FPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIP 150
           FPGVGAFA AMDVLN+TGMAEALC YIE DRPFLGICLGLQLLF SSEENGPV GLG+IP
Sbjct: 105 FPGVGAFAPAMDVLNRTGMAEALCKYIENDRPFLGICLGLQLLFDSSEENGPVKGLGVIP 164

Query: 151 GVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSST 210
           G+VGRFD+S G RVP IGWNALQ+ KDSEILDDVG+ HVYFVHSYRA+PSD+NK+W+SST
Sbjct: 165 GIVGRFDASAGIRVPHIGWNALQVGKDSEILDDVGNRHVYFVHSYRAIPSDENKDWISST 224

Query: 211 CNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALKLAKRV 270
           CNYG++FI+S+RRGNVHAVQFHPEKSG+VGLSVLRRFLHPK    +KP EGKA KLAKRV
Sbjct: 225 CNYGESFISSIRRGNVHAVQFHPEKSGEVGLSVLRRFLHPKLPATQKPMEGKASKLAKRV 284

Query: 271 IACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNIT 330
           IACLDVR NDKGDLVVTKGDQYDVRE + ENEVRNLGKPV+LA QYYK+GADEISFLNIT
Sbjct: 285 IACLDVRTNDKGDLVVTKGDQYDVREQSNENEVRNLGKPVDLAGQYYKDGADEISFLNIT 344

Query: 331 GFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADK 390
           GFRDFPLGDLPM+QVLR TS+NVFVPLTVGGGIRDFTDA+GR+YSSLEVA+EYFRSGADK
Sbjct: 345 GFRDFPLGDLPMIQVLRQTSKNVFVPLTVGGGIRDFTDASGRYYSSLEVAAEYFRSGADK 404

Query: 391 ISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAV 450
           ISIGSDAV AAE+++K+GVKTGKSSLEQISRVYGNQAVVVSIDPRRVY+ HP+DV +K +
Sbjct: 405 ISIGSDAVSAAEEFIKSGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYVNHPDDVPYKVI 464

Query: 451 RVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFD 510
           RVT+ GPNGEEYAWYQCTV+GGREGRPIGA+ELAKAVE+LGAGEILLNCIDCDGQGKGFD
Sbjct: 465 RVTNPGPNGEEYAWYQCTVSGGREGRPIGAFELAKAVEELGAGEILLNCIDCDGQGKGFD 524

Query: 511 MDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLY 570
           +DL+KLISD+V IPVIASSGAG  +HFS+VF KTNASAALAAGIFHRKEVPIQSVKEHL 
Sbjct: 525 IDLVKLISDSVGIPVIASSGAGTPDHFSEVFEKTNASAALAAGIFHRKEVPIQSVKEHLQ 584

Query: 571 KEGIEVRI 578
           +E IEVRI
Sbjct: 585 EERIEVRI 592
IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The glutamine amidotransferase domain provides the ammonia necessary to the cyclase domain to produce IGP and AICAR from PRFAR.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 1EC: .EC: 3EC: .EC: -
>sp|O94303|HIS5_SCHPO Imidazole glycerol phosphate synthase hisHF OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his4 PE=3 SV=3 Back     alignment and function description
>sp|Q9P4P9|HIS5_EMENI Imidazole glycerol phosphate synthase hisHF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hisHF PE=3 SV=2 Back     alignment and function description
>sp|P33734|HIS5_YEAST Imidazole glycerol phosphate synthase hisHF OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS7 PE=1 SV=2 Back     alignment and function description
>sp|A6UR05|HIS6_METVS Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisF PE=3 SV=1 Back     alignment and function description
>sp|A5UMZ1|HIS6_METS3 Imidazole glycerol phosphate synthase subunit HisF OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisF PE=3 SV=1 Back     alignment and function description
>sp|A4G0J7|HIS6_METM5 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisF PE=3 SV=1 Back     alignment and function description
>sp|O27398|HIS6_METTH Imidazole glycerol phosphate synthase subunit HisF OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisF PE=3 SV=2 Back     alignment and function description
>sp|A6VHY8|HIS6_METM7 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisF PE=3 SV=1 Back     alignment and function description
>sp|Q2NI84|HIS6_METST Imidazole glycerol phosphate synthase subunit HisF OS=Methanosphaera stadtmanae (strain DSM 3091) GN=hisF PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query578
255578102595 imidazole glycerol phosphate synthase su 0.960 0.932 0.873 0.0
225460917588 PREDICTED: imidazole glycerol phosphate 0.955 0.938 0.871 0.0
356567330580 PREDICTED: imidazole glycerol phosphate 0.942 0.939 0.879 0.0
356567431580 PREDICTED: imidazole glycerol phosphate 0.982 0.979 0.845 0.0
449517677593 PREDICTED: imidazole glycerol phosphate 0.961 0.937 0.863 0.0
449444210593 PREDICTED: imidazole glycerol phosphate 0.961 0.937 0.863 0.0
224059636584 predicted protein [Populus trichocarpa] 0.942 0.933 0.861 0.0
15236905592 cyclase [Arabidopsis thaliana] gi|126438 0.946 0.923 0.848 0.0
26452024592 putative glutamine amidotransferase/cycl 0.946 0.923 0.846 0.0
224104061583 predicted protein [Populus trichocarpa] 0.955 0.946 0.837 0.0
>gi|255578102|ref|XP_002529921.1| imidazole glycerol phosphate synthase subunit hisf, putative [Ricinus communis] gi|223530598|gb|EEF32475.1| imidazole glycerol phosphate synthase subunit hisf, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/561 (87%), Positives = 521/561 (92%), Gaps = 6/561 (1%)

Query: 22  NEFYKIQNRVKFKSPRALSIRATS-SDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTP 80
           N  YK  NR KFK PR LS+RA+S SDSVVTLLDYGAGNVRSVRNAIR+LGF IKDVQ+P
Sbjct: 37  NNLYK--NRSKFKPPRNLSVRASSTSDSVVTLLDYGAGNVRSVRNAIRYLGFQIKDVQSP 94

Query: 81  EDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEEN 140
            DILNA RLIFPGVGAFA A+D LN TGMAEAL  YIEKDRPFLGICLGLQLLF+SS+EN
Sbjct: 95  ADILNAKRLIFPGVGAFAPAIDFLNNTGMAEALSTYIEKDRPFLGICLGLQLLFESSDEN 154

Query: 141 GPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPS 200
           GPV GLGLIPGVVGRFDSSNGFRVP IGWNALQI  DSEILDD+G+HHVYFVHSYRAMPS
Sbjct: 155 GPVKGLGLIPGVVGRFDSSNGFRVPHIGWNALQIANDSEILDDIGNHHVYFVHSYRAMPS 214

Query: 201 DDNKEWVSSTCNYGDNFIASVRRGNVHAVQFHPEKSG---DVGLSVLRRFLHPKTNIPKK 257
            +NK+W+SSTCNYGDNFIASVRRGNVHAVQFHPEKSG   DVGL+VLRRFL P +++ KK
Sbjct: 215 HENKDWISSTCNYGDNFIASVRRGNVHAVQFHPEKSGGYADVGLTVLRRFLLPMSSLTKK 274

Query: 258 PTEGKALKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYY 317
           PTEGKA KLAKRVIACLDVR NDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELA QYY
Sbjct: 275 PTEGKASKLAKRVIACLDVRTNDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELAGQYY 334

Query: 318 KEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSL 377
           K+GADE+SFLNIT FRDFPLGDLPMLQVLR TSENVFVPLTVGGGIRDFTDANGR+YSSL
Sbjct: 335 KDGADEVSFLNITAFRDFPLGDLPMLQVLRCTSENVFVPLTVGGGIRDFTDANGRYYSSL 394

Query: 378 EVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRV 437
           EVASEYFRSGADKISIGSDAVYAAE+Y++T VKTGKSS+EQISRVYGNQAVVVSIDPRRV
Sbjct: 395 EVASEYFRSGADKISIGSDAVYAAEEYIRTKVKTGKSSIEQISRVYGNQAVVVSIDPRRV 454

Query: 438 YITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILL 497
           Y+  P+DVEFKAVRVT  GPNGEEYAWYQCTV+GGREGRPIGAYELAKAVE+LGAGEILL
Sbjct: 455 YLKSPSDVEFKAVRVTKPGPNGEEYAWYQCTVSGGREGRPIGAYELAKAVEELGAGEILL 514

Query: 498 NCIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHR 557
           NCIDCDGQGKGFD+DLI+LISDAVSIPVIASSGAGA EHF++VF KTNASAALAAGIFHR
Sbjct: 515 NCIDCDGQGKGFDIDLIQLISDAVSIPVIASSGAGAAEHFTEVFNKTNASAALAAGIFHR 574

Query: 558 KEVPIQSVKEHLYKEGIEVRI 578
           KEVPIQSVKEHL KEGIEVRI
Sbjct: 575 KEVPIQSVKEHLLKEGIEVRI 595

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225460917|ref|XP_002279105.1| PREDICTED: imidazole glycerol phosphate synthase hisHF, chloroplastic [Vitis vinifera] gi|297737461|emb|CBI26662.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356567330|ref|XP_003551874.1| PREDICTED: imidazole glycerol phosphate synthase hisHF, chloroplastic [Glycine max] Back     alignment and taxonomy information
>gi|356567431|ref|XP_003551923.1| PREDICTED: imidazole glycerol phosphate synthase hisHF, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449517677|ref|XP_004165871.1| PREDICTED: imidazole glycerol phosphate synthase hisHF, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444210|ref|XP_004139868.1| PREDICTED: imidazole glycerol phosphate synthase hisHF, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224059636|ref|XP_002299945.1| predicted protein [Populus trichocarpa] gi|222847203|gb|EEE84750.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15236905|ref|NP_194420.1| cyclase [Arabidopsis thaliana] gi|12643854|sp|Q9SZ30.1|HIS5_ARATH RecName: Full=Imidazole glycerol phosphate synthase hisHF, chloroplastic; Short=IGP synthase; Short=IGPS; Short=ImGP synthase; Includes: RecName: Full=Glutamine amidotransferase; Includes: RecName: Full=Cyclase; Flags: Precursor gi|4455213|emb|CAB36536.1| glutamine amidotransferase/cyclase [Arabidopsis thaliana] gi|7269543|emb|CAB79545.1| glutamine amidotransferase/cyclase [Arabidopsis thaliana] gi|332659866|gb|AEE85266.1| cyclase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|26452024|dbj|BAC43102.1| putative glutamine amidotransferase/cyclase [Arabidopsis thaliana] gi|29028958|gb|AAO64858.1| At4g26900 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224104061|ref|XP_002313301.1| predicted protein [Populus trichocarpa] gi|222849709|gb|EEE87256.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query578
TAIR|locus:2116422592 AT-HF "HIS HF" [Arabidopsis th 0.949 0.927 0.847 2.5e-255
POMBASE|SPBC418.01c541 his4 "imidazoleglycerol-phosph 0.906 0.968 0.520 8.6e-143
SGD|S000000452552 HIS7 "Imidazole glycerol phosp 0.913 0.956 0.506 8.3e-138
ASPGD|ASPL0000068850553 hisHF [Emericella nidulans (ta 0.911 0.952 0.499 3.8e-133
UNIPROTKB|G4NDI4555 MGG_00253 "Imidazole glycerol 0.690 0.718 0.576 7.9e-117
CGD|CAL0006063627 HIS7 [Candida albicans (taxid: 0.480 0.443 0.554 6.4e-106
UNIPROTKB|O53908267 hisF "Imidazole glycerol phosp 0.216 0.468 0.456 6.4e-40
TIGR_CMR|GSU_3095253 GSU_3095 "imidazoleglycerol ph 0.202 0.462 0.508 1.2e-39
TIGR_CMR|GSU_3097209 GSU_3097 "imidazole glycerol p 0.339 0.937 0.421 1.6e-38
TIGR_CMR|BA_1428209 BA_1428 "imidazole glycerol ph 0.335 0.928 0.395 6.8e-36
TAIR|locus:2116422 AT-HF "HIS HF" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2458 (870.3 bits), Expect = 2.5e-255, P = 2.5e-255
 Identities = 467/551 (84%), Positives = 515/551 (93%)

Query:    29 NRVKFKSPRALSIRATS-SDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNAN 87
             NR KFKSPR+LS+RA+S SDSVVTLLDYGAGNVRS+RNA+RHLGF IKDVQTP DILNA+
Sbjct:    43 NR-KFKSPRSLSVRASSTSDSVVTLLDYGAGNVRSIRNALRHLGFSIKDVQTPGDILNAD 101

Query:    88 RLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLG 147
             RLIFPGVGAFA AMDVLN+TGMAEALC YIE DRPFLGICLGLQLLF SSEENGPV GLG
Sbjct:   102 RLIFPGVGAFAPAMDVLNRTGMAEALCKYIENDRPFLGICLGLQLLFDSSEENGPVKGLG 161

Query:   148 LIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWV 207
             +IPG+VGRFD+S G RVP IGWNALQ+ KDSEILDDVG+ HVYFVHSYRA+PSD+NK+W+
Sbjct:   162 VIPGIVGRFDASAGIRVPHIGWNALQVGKDSEILDDVGNRHVYFVHSYRAIPSDENKDWI 221

Query:   208 SSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALKLA 267
             SSTCNYG++FI+S+RRGNVHAVQFHPEKSG+VGLSVLRRFLHPK    +KP EGKA KLA
Sbjct:   222 SSTCNYGESFISSIRRGNVHAVQFHPEKSGEVGLSVLRRFLHPKLPATQKPMEGKASKLA 281

Query:   268 KRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFL 327
             KRVIACLDVR NDKGDLVVTKGDQYDVRE + ENEVRNLGKPV+LA QYYK+GADEISFL
Sbjct:   282 KRVIACLDVRTNDKGDLVVTKGDQYDVREQSNENEVRNLGKPVDLAGQYYKDGADEISFL 341

Query:   328 NITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSG 387
             NITGFRDFPLGDLPM+QVLR TS+NVFVPLTVGGGIRDFTDA+GR+YSSLEVA+EYFRSG
Sbjct:   342 NITGFRDFPLGDLPMIQVLRQTSKNVFVPLTVGGGIRDFTDASGRYYSSLEVAAEYFRSG 401

Query:   388 ADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEF 447
             ADKISIGSDAV AAE+++K+GVKTGKSSLEQISRVYGNQAVVVSIDPRRVY+ HP+DV +
Sbjct:   402 ADKISIGSDAVSAAEEFIKSGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYVNHPDDVPY 461

Query:   448 KAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGK 507
             K +RVT+ GPNGEEYAWYQCTV+GGREGRPIGA+ELAKAVE+LGAGEILLNCIDCDGQGK
Sbjct:   462 KVIRVTNPGPNGEEYAWYQCTVSGGREGRPIGAFELAKAVEELGAGEILLNCIDCDGQGK 521

Query:   508 GFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKE 567
             GFD+DL+KLISD+V IPVIASSGAG  +HFS+VF KTNASAALAAGIFHRKEVPIQSVKE
Sbjct:   522 GFDIDLVKLISDSVGIPVIASSGAGTPDHFSEVFEKTNASAALAAGIFHRKEVPIQSVKE 581

Query:   568 HLYKEGIEVRI 578
             HL +E IEVRI
Sbjct:   582 HLQEERIEVRI 592
GO:0000105 "histidine biosynthetic process" evidence=IEA;IGI;IMP
GO:0000107 "imidazoleglycerol-phosphate synthase activity" evidence=IEA;IGI
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0016763 "transferase activity, transferring pentosyl groups" evidence=IEA
GO:0016833 "oxo-acid-lyase activity" evidence=IEA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009536 "plastid" evidence=IDA
POMBASE|SPBC418.01c his4 "imidazoleglycerol-phosphate synthase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000000452 HIS7 "Imidazole glycerol phosphate synthase (glutamine amidotransferase:cyc" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000068850 hisHF [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NDI4 MGG_00253 "Imidazole glycerol phosphate synthase subunit hisF" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
CGD|CAL0006063 HIS7 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|O53908 hisF "Imidazole glycerol phosphate synthase subunit HisF" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3095 GSU_3095 "imidazoleglycerol phosphate synthase, cyclase subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3097 GSU_3097 "imidazole glycerol phosphate synthase, glutamine amidotransferase subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1428 BA_1428 "imidazole glycerol phosphate synthase, glutamine amidotransferase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P33734HIS5_YEAST4, ., 1, ., 3, ., -0.50630.91340.9565yesno
O94303HIS5_SCHPO4, ., 1, ., 3, ., -0.51830.90650.9685yesno
Q9SZ30HIS5_ARATH4, ., 1, ., 3, ., -0.84850.94630.9239yesno
Q9P4P9HIS5_EMENI4, ., 1, ., 3, ., -0.50450.90480.9457yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.20.691
3rd Layer4.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027290001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (570 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00019988001
RecName- Full=Imidazoleglycerol-phosphate dehydratase; EC=4.2.1.19; (180 aa)
• •• •• 0.998
GSVIVG00021607001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (306 aa)
• •• •• 0.993
GSVIVG00002274001
RecName- Full=Histidinol dehydrogenase; EC=1.1.1.23;; Catalyzes the sequential NAD-dependent ox [...] (438 aa)
• •• •• 0.988
GSVIVG00037970001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (289 aa)
• •• •• 0.981
GSVIVG00035413001
SubName- Full=Chromosome chr12 scaffold_78, whole genome shotgun sequence; (390 aa)
• ••  • 0.954
GSVIVG00031801001
SubName- Full=Chromosome chr18 scaffold_59, whole genome shotgun sequence; (269 aa)
• ••  • 0.945
GSVIVG00024606001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (288 aa)
• ••  • 0.943
GSVIVG00008008001
SubName- Full=Chromosome undetermined scaffold_1178, whole genome shotgun sequence; (352 aa)
•  • •• 0.880
GSVIVG00029073001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (396 aa)
•     • 0.860
GSVIVG00025551001
RecName- Full=Adenylosuccinate synthetase; EC=6.3.4.4;; Plays an important role in the de novo [...] (489 aa)
   •  • 0.838

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
PLN02617538 PLN02617, PLN02617, imidazole glycerol phosphate s 0.0
cd04731243 cd04731, HisF, The cyclase subunit of imidazolegly 1e-106
COG0107256 COG0107, HisF, Imidazoleglycerol-phosphate synthas 1e-106
cd01748198 cd01748, GATase1_IGP_Synthase, Type 1 glutamine am 1e-105
TIGR00735254 TIGR00735, hisF, imidazoleglycerol phosphate synth 1e-102
PRK13141205 PRK13141, hisH, imidazole glycerol phosphate synth 3e-96
PRK02083253 PRK02083, PRK02083, imidazole glycerol phosphate s 1e-92
COG0118204 COG0118, HisH, Glutamine amidotransferase [Amino a 1e-85
PRK13181199 PRK13181, hisH, imidazole glycerol phosphate synth 2e-79
PRK13146209 PRK13146, hisH, imidazole glycerol phosphate synth 7e-79
PRK13143200 PRK13143, hisH, imidazole glycerol phosphate synth 9e-75
TIGR01855196 TIGR01855, IMP_synth_hisH, imidazole glycerol phos 9e-70
PRK13170196 PRK13170, hisH, imidazole glycerol phosphate synth 3e-57
pfam00977230 pfam00977, His_biosynth, Histidine biosynthesis pr 3e-55
PRK13152201 PRK13152, hisH, imidazole glycerol phosphate synth 5e-55
TIGR03572232 TIGR03572, WbuZ, glycosyl amidation-associated pro 2e-53
CHL00188210 CHL00188, hisH, imidazole glycerol phosphate synth 1e-52
PRK13142192 PRK13142, hisH, imidazole glycerol phosphate synth 8e-45
PRK14004210 PRK14004, hisH, imidazole glycerol phosphate synth 6e-44
PRK01033258 PRK01033, PRK01033, imidazole glycerol phosphate s 4e-41
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 1e-31
cd04723233 cd04723, HisA_HisF, Phosphoribosylformimino-5-amin 4e-28
cd04732234 cd04732, HisA, HisA 2e-20
TIGR00007230 TIGR00007, TIGR00007, phosphoribosylformimino-5-am 3e-19
COG0106241 COG0106, HisA, Phosphoribosylformimino-5-aminoimid 4e-18
PRK13585241 PRK13585, PRK13585, 1-(5-phosphoribosyl)-5-[(5- ph 1e-16
PRK13525189 PRK13525, PRK13525, glutamine amidotransferase sub 5e-10
PRK00748233 PRK00748, PRK00748, 1-(5-phosphoribosyl)-5-[(5- ph 3e-09
cd01750194 cd01750, GATase1_CobQ, Type 1 glutamine amidotrans 4e-09
cd01749183 cd01749, GATase1_PB, Glutamine Amidotransferase (G 5e-09
COG0311194 COG0311, PDX2, Predicted glutamine amidotransferas 1e-08
TIGR03800184 TIGR03800, PLP_synth_Pdx2, pyridoxal 5'-phosphate 6e-08
pfam01174188 pfam01174, SNO, SNO glutamine amidotransferase fam 7e-08
pfam07685157 pfam07685, GATase_3, CobB/CobQ-like glutamine amid 9e-08
PRK13527200 PRK13527, PRK13527, glutamine amidotransferase sub 3e-07
cd01741188 cd01741, GATase1_1, Subgroup of proteins having th 3e-07
PRK00784488 PRK00784, PRK00784, cobyric acid synthase; Provisi 3e-07
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase 6e-07
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferas 6e-07
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 1e-06
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glu 1e-06
COG0518198 COG0518, GuaA, GMP synthase - Glutamine amidotrans 5e-06
COG1492486 COG1492, CobQ, Cobyric acid synthase [Coenzyme met 1e-05
PRK13587234 PRK13587, PRK13587, 1-(5-phosphoribosyl)-5-[(5- ph 3e-05
TIGR01815717 TIGR01815, TrpE-clade3, anthranilate synthase, alp 4e-04
TIGR00888188 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hyd 0.002
TIGR03151307 TIGR03151, enACPred_II, putative enoyl-[acyl-carri 0.002
TIGR02129253 TIGR02129, hisA_euk, phosphoribosylformimino-5-ami 0.002
PRK00074511 PRK00074, guaA, GMP synthase; Reviewed 0.004
>gnl|CDD|178226 PLN02617, PLN02617, imidazole glycerol phosphate synthase hisHF Back     alignment and domain information 
 Score = 1109 bits (2869), Expect = 0.0
 Identities = 453/537 (84%), Positives = 493/537 (91%), Gaps = 1/537 (0%)

Query: 43  ATSSDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMD 102
           + S+DS VTLLDYGAGNVRSVRNAIRHLGF IKDVQTPEDILNA+RLIFPGVGAF +AMD
Sbjct: 2   SNSADSEVTLLDYGAGNVRSVRNAIRHLGFTIKDVQTPEDILNADRLIFPGVGAFGSAMD 61

Query: 103 VLNKTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGF 162
           VLN  GMAEAL  YI+ DRPFLGICLGLQLLF+SSEENGPV GLG+IPGVVGRFDSSNG 
Sbjct: 62  VLNNRGMAEALREYIQNDRPFLGICLGLQLLFESSEENGPVEGLGVIPGVVGRFDSSNGL 121

Query: 163 RVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKEWVSSTCNYGDNFIASVR 222
           RVP IGWNALQITKDSE+LD VG  HVYFVHSYRA PSD+NK+WV +TCNYG  FIASVR
Sbjct: 122 RVPHIGWNALQITKDSELLDGVGGRHVYFVHSYRATPSDENKDWVLATCNYGGEFIASVR 181

Query: 223 RGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPTEGKALK-LAKRVIACLDVRANDK 281
           +GNVHAVQFHPEKSG  GLS+LRRFL PK++  +KPTEGKA K LAKRVIACLDVR+NDK
Sbjct: 182 KGNVHAVQFHPEKSGATGLSILRRFLEPKSSATQKPTEGKASKSLAKRVIACLDVRSNDK 241

Query: 282 GDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLP 341
           GDLVVTKGDQYDVREH++  EVRNLGKPVELA QYYK+GADE++FLNITGFRDFPLGDLP
Sbjct: 242 GDLVVTKGDQYDVREHSEGREVRNLGKPVELAGQYYKDGADEVAFLNITGFRDFPLGDLP 301

Query: 342 MLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAA 401
           ML+VLR  SENVFVPLTVGGGIRDFTDANGR+YSSLEVASEYFRSGADKISIGSDAVYAA
Sbjct: 302 MLEVLRRASENVFVPLTVGGGIRDFTDANGRYYSSLEVASEYFRSGADKISIGSDAVYAA 361

Query: 402 EDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEE 461
           E+Y+ +GVKTGK+S+EQISRVYGNQAVVVSIDPRRVY+  P+DV FK V+VT+ GPNGEE
Sbjct: 362 EEYIASGVKTGKTSIEQISRVYGNQAVVVSIDPRRVYVKDPSDVPFKTVKVTNPGPNGEE 421

Query: 462 YAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAV 521
           YAWYQCTV GGREGRPIGAYELAKAVE+LGAGEILLNCIDCDGQGKGFD++L+KL+SDAV
Sbjct: 422 YAWYQCTVKGGREGRPIGAYELAKAVEELGAGEILLNCIDCDGQGKGFDIELVKLVSDAV 481

Query: 522 SIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI 578
           +IPVIASSGAG  EHFSDVF KTNASAALAAGIFHRKEVPI SVKEHL +EGIE RI
Sbjct: 482 TIPVIASSGAGTPEHFSDVFSKTNASAALAAGIFHRKEVPISSVKEHLLEEGIETRI 538

Length = 538
>gnl|CDD|240082 cd04731, HisF, The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>gnl|CDD|223185 COG0107, HisF, Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>gnl|CDD|233108 TIGR00735, hisF, imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>gnl|CDD|237288 PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|234996 PRK02083, PRK02083, imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>gnl|CDD|223196 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183878 PRK13181, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|237290 PRK13146, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|237289 PRK13143, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|233601 TIGR01855, IMP_synth_hisH, imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>gnl|CDD|183877 PRK13170, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|216225 pfam00977, His_biosynth, Histidine biosynthesis protein Back     alignment and domain information
>gnl|CDD|171876 PRK13152, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|132611 TIGR03572, WbuZ, glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>gnl|CDD|214389 CHL00188, hisH, imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>gnl|CDD|171871 PRK13142, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|172505 PRK14004, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|234891 PRK01033, PRK01033, imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|240074 cd04723, HisA_HisF, Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>gnl|CDD|240083 cd04732, HisA, HisA Back     alignment and domain information
>gnl|CDD|232779 TIGR00007, TIGR00007, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>gnl|CDD|223184 COG0106, HisA, Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184165 PRK13585, PRK13585, 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|237411 PRK13525, PRK13525, glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>gnl|CDD|179108 PRK00748, PRK00748, 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>gnl|CDD|153221 cd01750, GATase1_CobQ, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>gnl|CDD|153220 cd01749, GATase1_PB, Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>gnl|CDD|223388 COG0311, PDX2, Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|163512 TIGR03800, PLP_synth_Pdx2, pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>gnl|CDD|201639 pfam01174, SNO, SNO glutamine amidotransferase family Back     alignment and domain information
>gnl|CDD|219513 pfam07685, GATase_3, CobB/CobQ-like glutamine amidotransferase domain Back     alignment and domain information
>gnl|CDD|237412 PRK13527, PRK13527, glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|234838 PRK00784, PRK00784, cobyric acid synthase; Provisional Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|224409 COG1492, CobQ, Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|172156 PRK13587, PRK13587, 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|130874 TIGR01815, TrpE-clade3, anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>gnl|CDD|132195 TIGR03151, enACPred_II, putative enoyl-[acyl-carrier-protein] reductase II Back     alignment and domain information
>gnl|CDD|162719 TIGR02129, hisA_euk, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 578
PLN02617538 imidazole glycerol phosphate synthase hisHF 100.0
KOG0623541 consensus Glutamine amidotransferase/cyclase [Amin 100.0
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 100.0
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 100.0
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 100.0
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 100.0
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 100.0
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 100.0
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 100.0
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 100.0
PRK14024241 phosphoribosyl isomerase A; Provisional 100.0
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 100.0
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 100.0
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 100.0
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 100.0
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 100.0
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 100.0
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 100.0
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 100.0
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 100.0
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 100.0
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 100.0
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 100.0
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 100.0
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 100.0
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 100.0
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 100.0
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 99.98
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 99.98
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 99.97
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 99.97
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 99.97
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.97
COG1411229 Uncharacterized protein related to proFAR isomeras 99.96
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.96
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 99.96
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.96
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 99.93
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 99.93
PRK06895190 putative anthranilate synthase component II; Provi 99.93
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 99.93
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 99.92
PLN02347536 GMP synthetase 99.92
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 99.92
PRK00758184 GMP synthase subunit A; Validated 99.92
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.91
PRK06774191 para-aminobenzoate synthase component II; Provisio 99.91
PRK08007187 para-aminobenzoate synthase component II; Provisio 99.91
PRK05670189 anthranilate synthase component II; Provisional 99.91
PRK00074511 guaA GMP synthase; Reviewed 99.91
CHL00101190 trpG anthranilate synthase component 2 99.91
PLN02335222 anthranilate synthase 99.9
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 99.9
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 99.9
PRK05637208 anthranilate synthase component II; Provisional 99.89
PRK07765214 para-aminobenzoate synthase component II; Provisio 99.89
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 99.89
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 99.89
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 99.89
PRK12564360 carbamoyl phosphate synthase small subunit; Review 99.89
PRK08857193 para-aminobenzoate synthase component II; Provisio 99.88
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 99.88
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.88
PRK13566720 anthranilate synthase; Provisional 99.88
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 99.87
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.87
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.87
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.86
PRK06490239 glutamine amidotransferase; Provisional 99.86
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 99.85
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.85
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 99.84
PRK09522531 bifunctional glutamine amidotransferase/anthranila 99.84
PRK07053234 glutamine amidotransferase; Provisional 99.83
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 99.83
KOG3055263 consensus Phosphoribosylformimino-5-aminoimidazole 99.83
COG2071243 Predicted glutamine amidotransferases [General fun 99.83
PRK05665240 amidotransferase; Provisional 99.83
PRK09065237 glutamine amidotransferase; Provisional 99.82
PLN02889 918 oxo-acid-lyase/anthranilate synthase 99.81
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 99.81
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 99.81
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 99.81
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 99.8
PRK14607534 bifunctional glutamine amidotransferase/anthranila 99.8
PRK08250235 glutamine amidotransferase; Provisional 99.8
PRK06186229 hypothetical protein; Validated 99.8
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 99.8
COG0311194 PDX2 Predicted glutamine amidotransferase involved 99.79
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.78
KOG0026223 consensus Anthranilate synthase, beta chain [Amino 99.77
PRK07567242 glutamine amidotransferase; Provisional 99.77
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 99.77
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 99.76
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.76
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.75
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 99.74
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.73
KOG1622552 consensus GMP synthase [Nucleotide transport and m 99.72
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.71
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 99.71
PRK05380533 pyrG CTP synthetase; Validated 99.7
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.69
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.68
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 99.66
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 99.64
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 99.64
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 99.63
PLN02327557 CTP synthase 99.62
PRK00784488 cobyric acid synthase; Provisional 99.62
KOG1224 767 consensus Para-aminobenzoate (PABA) synthase ABZ1 99.61
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 99.58
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 99.57
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 99.55
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 99.54
PRK06278476 cobyrinic acid a,c-diamide synthase; Validated 99.52
TIGR00313475 cobQ cobyric acid synthase CobQ. 99.51
PRK01033 258 imidazole glycerol phosphate synthase subunit HisF 99.48
cd04731 243 HisF The cyclase subunit of imidazoleglycerol phos 99.48
COG0107 256 HisF Imidazoleglycerol-phosphate synthase [Amino a 99.46
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.46
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.46
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 99.45
KOG3210226 consensus Imidazoleglycerol-phosphate synthase sub 99.44
TIGR00735 254 hisF imidazoleglycerol phosphate synthase, cyclase 99.43
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 99.39
TIGR03572 232 WbuZ glycosyl amidation-associated protein WbuZ. T 99.38
PRK00748 233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.37
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 99.37
COG3442250 Predicted glutamine amidotransferase [General func 99.37
PRK04128 228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.35
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 99.34
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 99.29
PRK02083 253 imidazole glycerol phosphate synthase subunit HisF 99.29
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.28
KOG2387585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 99.27
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 99.23
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 99.22
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 99.2
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 99.19
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 99.19
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 99.17
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 99.17
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 99.16
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 99.15
PRK05368302 homoserine O-succinyltransferase; Provisional 99.14
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.13
TIGR00007 230 phosphoribosylformimino-5-aminoimidazole carboxami 99.1
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.1
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.09
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 99.09
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 99.06
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.03
KOG1559340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 99.02
cd04732 234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 99.01
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 99.01
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 99.0
PRK14024 241 phosphoribosyl isomerase A; Provisional 98.99
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 98.97
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 98.95
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 98.94
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 98.93
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 98.91
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 98.9
PRK13586 232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.88
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 98.87
PLN02274505 inosine-5'-monophosphate dehydrogenase 98.83
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 98.8
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 98.78
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 98.77
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 98.74
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 98.74
PLN02617 538 imidazole glycerol phosphate synthase hisHF 98.73
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 98.73
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 98.72
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 98.71
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 98.71
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 98.67
cd02812219 PcrB_like PcrB_like proteins. One member of this f 98.66
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 98.65
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 98.64
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 98.62
TIGR02129 253 hisA_euk phosphoribosylformimino-5-aminoimidazole 98.61
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.61
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 98.6
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.59
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 98.59
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 98.59
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 98.58
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 98.57
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 98.55
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 98.54
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 98.51
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 98.49
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 98.48
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 98.47
PLN02334229 ribulose-phosphate 3-epimerase 98.46
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 98.45
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 98.43
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 98.43
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 98.43
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.42
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 98.41
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 98.41
PLN02460338 indole-3-glycerol-phosphate synthase 98.38
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 98.38
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 98.38
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 98.37
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 98.37
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 98.36
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 98.36
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 98.35
PRK07695201 transcriptional regulator TenI; Provisional 98.35
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 98.34
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 98.34
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 98.29
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.29
cd02812219 PcrB_like PcrB_like proteins. One member of this f 98.28
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 98.28
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 98.27
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 98.26
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 98.25
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 98.25
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 98.25
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 98.23
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 98.22
PRK00208250 thiG thiazole synthase; Reviewed 98.21
PRK13523337 NADPH dehydrogenase NamA; Provisional 98.2
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 98.2
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 98.19
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 98.19
PHA033661304 FGAM-synthase; Provisional 98.19
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 98.19
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 98.19
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 98.19
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 98.17
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 98.17
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 98.17
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 98.15
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.15
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.13
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 98.12
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 98.11
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 98.11
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 98.11
PRK05581220 ribulose-phosphate 3-epimerase; Validated 98.1
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 98.1
PRK04302223 triosephosphate isomerase; Provisional 98.09
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 98.09
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 98.09
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.08
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 98.08
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 98.08
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 98.07
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 98.07
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 98.04
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 98.03
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 98.01
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 97.98
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 97.97
COG1411229 Uncharacterized protein related to proFAR isomeras 97.97
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 97.96
PLN02591250 tryptophan synthase 97.94
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 97.94
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 97.9
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 97.9
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 97.86
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 97.86
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 97.85
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 97.85
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 97.83
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 97.83
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 97.82
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 97.81
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 97.81
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 97.79
PRK08005210 epimerase; Validated 97.78
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 97.78
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 97.77
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 97.76
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 97.76
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 97.76
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 97.73
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 97.7
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 97.68
PLN02826409 dihydroorotate dehydrogenase 97.68
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 97.68
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 97.66
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 97.64
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 97.64
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 97.64
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.64
PRK06806281 fructose-bisphosphate aldolase; Provisional 97.64
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 97.61
KOG2333 614 consensus Uncharacterized conserved protein [Gener 97.6
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 97.59
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 97.58
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 97.56
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 97.56
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 97.55
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 97.54
PRK06801286 hypothetical protein; Provisional 97.54
PRK11572248 copper homeostasis protein CutC; Provisional 97.54
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 97.54
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.51
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 97.51
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 97.49
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 97.49
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 97.49
PRK08999312 hypothetical protein; Provisional 97.49
PRK08185283 hypothetical protein; Provisional 97.48
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.48
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 97.46
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.46
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 97.45
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 97.44
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 97.43
PRK08091228 ribulose-phosphate 3-epimerase; Validated 97.41
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 97.41
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 97.41
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 97.41
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.39
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 97.39
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 97.39
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 97.39
PRK14057254 epimerase; Provisional 97.38
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 97.37
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 97.36
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 97.35
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 97.35
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 97.35
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 97.35
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 97.3
PLN02535364 glycolate oxidase 97.3
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 97.28
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 97.27
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 97.27
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 97.26
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 97.24
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 97.24
PRK07226267 fructose-bisphosphate aldolase; Provisional 97.23
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 97.22
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 97.22
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 97.2
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 97.18
PRK08649 368 inosine 5-monophosphate dehydrogenase; Validated 97.18
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 97.17
PRK00208250 thiG thiazole synthase; Reviewed 97.17
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 97.17
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 97.17
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 97.17
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 97.16
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.16
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 97.16
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 97.13
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 97.13
PRK07315293 fructose-bisphosphate aldolase; Provisional 97.13
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 97.1
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.1
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.1
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 97.1
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 97.09
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 97.09
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 97.09
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 97.08
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 97.08
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 97.07
PLN02591250 tryptophan synthase 97.04
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 97.04
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 97.03
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 97.03
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 97.01
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 96.99
KOG2334 477 consensus tRNA-dihydrouridine synthase [Translatio 96.98
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 96.96
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 96.93
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 96.92
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 96.91
PRK10605362 N-ethylmaleimide reductase; Provisional 96.89
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 96.87
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.87
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 96.86
PRK07709285 fructose-bisphosphate aldolase; Provisional 96.86
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 96.86
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 96.83
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 96.82
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 96.77
KOG4201289 consensus Anthranilate synthase component II [Amin 96.76
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 96.76
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 96.75
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 96.73
PF09825367 BPL_N: Biotin-protein ligase, N terminal; InterPro 96.73
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 96.73
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 96.72
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 96.72
PLN02334229 ribulose-phosphate 3-epimerase 96.72
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 96.68
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 96.67
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 96.66
PRK11197381 lldD L-lactate dehydrogenase; Provisional 96.66
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 96.66
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 96.65
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 96.63
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 96.61
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 96.58
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 96.58
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 96.58
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 96.55
PRK05835307 fructose-bisphosphate aldolase; Provisional 96.54
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 96.54
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 96.53
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 96.53
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 96.47
PRK04155287 chaperone protein HchA; Provisional 96.46
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 96.46
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 96.45
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 96.45
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 96.42
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 96.39
PLN02979366 glycolate oxidase 96.38
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 96.37
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 96.34
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 96.32
PRK11574196 oxidative-stress-resistance chaperone; Provisional 96.29
COG3142241 CutC Uncharacterized protein involved in copper re 96.29
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 96.28
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 96.26
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 96.26
PLN02826409 dihydroorotate dehydrogenase 96.26
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 96.23
PRK08610286 fructose-bisphosphate aldolase; Reviewed 96.23
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 96.22
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 96.2
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 96.17
PRK13523337 NADPH dehydrogenase NamA; Provisional 96.16
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 96.12
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 96.1
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 96.1
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 96.09
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 96.08
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 96.06
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 96.05
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 96.04
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 96.04
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 96.03
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 96.01
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 96.01
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 96.0
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 96.0
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 95.99
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 95.98
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 95.97
CHL00162267 thiG thiamin biosynthesis protein G; Validated 95.96
PRK07084321 fructose-bisphosphate aldolase; Provisional 95.93
PRK05581220 ribulose-phosphate 3-epimerase; Validated 95.92
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.9
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 95.89
PRK08091228 ribulose-phosphate 3-epimerase; Validated 95.87
KOG19071320 consensus Phosphoribosylformylglycinamidine syntha 95.87
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 95.83
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 95.82
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 95.74
PRK04302223 triosephosphate isomerase; Provisional 95.74
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 95.72
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 95.72
KOG1436398 consensus Dihydroorotate dehydrogenase [Nucleotide 95.71
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 95.71
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 95.71
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 95.69
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 95.69
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 95.66
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 95.65
COG3340224 PepE Peptidase E [Amino acid transport and metabol 95.64
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 95.64
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 95.6
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 95.56
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 95.53
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 95.49
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 95.48
PRK14057254 epimerase; Provisional 95.47
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 95.46
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 95.46
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 95.46
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 95.44
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 95.41
PRK08005210 epimerase; Validated 95.39
PRK00507221 deoxyribose-phosphate aldolase; Provisional 95.38
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 95.37
TIGR00381389 cdhD CO dehydrogenase/acetyl-CoA synthase, delta s 95.35
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 95.3
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 95.28
PRK07695201 transcriptional regulator TenI; Provisional 95.26
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 95.24
KOG2764247 consensus Putative transcriptional regulator DJ-1 95.24
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 95.17
PRK11249752 katE hydroperoxidase II; Provisional 95.16
PLN02274505 inosine-5'-monophosphate dehydrogenase 95.16
TIGR01334277 modD putative molybdenum utilization protein ModD. 95.15
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 95.14
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 95.12
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information 
Probab=100.00  E-value=5.4e-95  Score=790.94  Aligned_cols=533  Identities=84%  Similarity=1.324  Sum_probs=472.7

Q ss_pred             CCcEEEEEECCCCCHHHHHHHHHHCCCeEEEeCCccCCCCCCEEEECCCCCchHHHHHHHhhcHHHHHHHHHhCCCCEEE
Q 045794           46 SDSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPEDILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFLG  125 (578)
Q Consensus        46 ~~~~I~vld~~~g~~~~i~~~L~~~Gv~v~~v~~~~dl~~~DGlILpGGg~~~~~~~~l~~~~l~~~i~~~~~~g~PIlG  125 (578)
                      ..++|+|+||++||..++.++|+++|+++.+++.++++.++|+|||||++++...+.++...++.+.|+++++.++|+||
T Consensus         5 ~~~~i~iiDyG~GN~~sl~~al~~~G~~v~~v~~~~~l~~~D~lIlpG~gs~~~~m~~L~~~gl~~~i~~~i~~g~PvLG   84 (538)
T PLN02617          5 ADSEVTLLDYGAGNVRSVRNAIRHLGFTIKDVQTPEDILNADRLIFPGVGAFGSAMDVLNNRGMAEALREYIQNDRPFLG   84 (538)
T ss_pred             CCCeEEEEECCCCCHHHHHHHHHHCCCeEEEECChhhhccCCEEEECCCCCHHHHHHHHHHcCHHHHHHHHHHcCCCEEE
Confidence            45679999999999999999999999999999988889999999999999887777777766788999999999999999


Q ss_pred             EechHHHHhhhcccCCCcCCCcccCceeeeecCCCCCCcceeeeEEEEEccCCcccccCCCeEEEEEeeeeeecCCCCCC
Q 045794          126 ICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKE  205 (578)
Q Consensus       126 IClG~QlLa~a~~e~~~~~Glgl~~~~v~~~~~~~~~~~~~~G~~~i~~~~~~~l~~~l~~~~~~~~H~~~v~~~~~~~~  205 (578)
                      ||+|||+|+.++.|++...|+|++++++.++........|++||+.+....+++++.+++...+|++|++++...+....
T Consensus        85 IC~G~QlLa~~~~E~g~~~glg~l~G~v~~~~~~~~~~vp~iGw~~V~~~~~spL~~~l~~~~vy~vHSy~v~~~p~~~~  164 (538)
T PLN02617         85 ICLGLQLLFESSEENGPVEGLGVIPGVVGRFDSSNGLRVPHIGWNALQITKDSELLDGVGGRHVYFVHSYRATPSDENKD  164 (538)
T ss_pred             ECHHHHHHhhhhhhcCCccCcccccceEEECCccCCCCCCeecceEEEecCCChhHhcCCCcEEEEEeEEEEEecCCCCc
Confidence            99999999998777667889999999998874332356789999999998888999888777889999999766555445


Q ss_pred             cEEEEeecCCceEEEEEeCCEEEEeeCCcccCcchHHHHHHHhhhccCCCCCCC-cccccccceeEEEeeeEeecCCCCE
Q 045794          206 WVSSTCNYGDNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPKKPT-EGKALKLAKRVIACLDVRANDKGDL  284 (578)
Q Consensus       206 ~~~~~~~~~d~~iegi~~~~i~gvQFHPE~~~~~~~~l~~~Fl~~~~~~~~~~~-~~~~~~~~~riIp~iDl~~~~~g~~  284 (578)
                      ++.++..++++++++++++++||+|||||.+...+..+|++|++.+.......+ ..+...+++|||||||++.+++|..
T Consensus       165 ~v~a~~~~g~~~IaAI~~gnI~GVQFHPE~s~~~G~~L~~nFl~~~~~~~~~~~~~~~~~~l~~riip~l~v~~~~~g~~  244 (538)
T PLN02617        165 WVLATCNYGGEFIASVRKGNVHAVQFHPEKSGATGLSILRRFLEPKSSATQKPTEGKASKSLAKRVIACLDVRSNDKGDL  244 (538)
T ss_pred             EEEEEEccCCCcEEEEEeCCEEEEEcCCccCchhHHHHHHHHHHhhhhhhcCccccccccCccceEEEEEEeecCCCCce
Confidence            566677777789999999999999999999877888999999988875533211 1223678899999999995433777


Q ss_pred             EEEecceeeeeeccccccEEecCCHHHHHHHHHHcCCCeEEEEecccCCCCCCCCchhHHHHHHHhhhccccEEEeCCcc
Q 045794          285 VVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIR  364 (578)
Q Consensus       285 v~~~G~~~~~~~~~~~~~~~~~~~p~~~a~~~~~~g~~~i~~~Dl~~~~~~~~~~~~~~~~i~~i~~~~~~pi~~gGGir  364 (578)
                      |+|||.+|++|+.......++.+||+++|++|+++||||||++||++++.+...+..++++|+++++++++|+++|||||
T Consensus       245 ~v~kg~~f~~~~~~~~~~~~~~gdPve~a~~y~~~Gadel~~~Di~~~~~~~~~~~~~~~~i~~i~~~~~ip~~vGGGIr  324 (538)
T PLN02617        245 VVTKGDQYDVREHSEGREVRNLGKPVELAGQYYKDGADEVAFLNITGFRDFPLGDLPMLEVLRRASENVFVPLTVGGGIR  324 (538)
T ss_pred             EEeecccccccccccccCCCcCCCHHHHHHHHHHcCCCEEEEEECCCCcCCcccchhHHHHHHHHHhhCCCCEEEcCCcc
Confidence            79999999888876555778899999999999999999999999999876666778899999999999999999999999


Q ss_pred             ccccCCCCccChHHHHHHHHHcCcceeecchhhhccchhhhhccccCCchHHHHHHHhCCCCeEEEEEeccccccCCCCc
Q 045794          365 DFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYITHPND  444 (578)
Q Consensus       365 ~~~d~~~~~~~~~~~~~~~l~~Ga~~vv~gt~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~iv~slD~~~~~~~~~~~  444 (578)
                      ++||+||+-+|.+|+++++|++|||||+|||+|++++++|+..++++||+++++++++||+|+|++|||+|++++..|..
T Consensus       325 ~~~d~~~~~~~~~e~~~~~l~~GadkV~i~s~Av~~~~~~~~~~~~~~p~~i~~~~~~fg~q~ivvsiD~k~~~~~~~~~  404 (538)
T PLN02617        325 DFTDANGRYYSSLEVASEYFRSGADKISIGSDAVYAAEEYIASGVKTGKTSIEQISRVYGNQAVVVSIDPRRVYVKDPSD  404 (538)
T ss_pred             ccccccccccchHHHHHHHHHcCCCEEEEChHHHhChhhhhccccccCHHHHHHHHHHcCCceEEEEEecCcCcccCccc
Confidence            99999999999999999999999999999999999988899999999999999999999999999999999875433444


Q ss_pred             cccceeeeccCCCCCCCcceEEEEEcccccCCCCCHHHHHHHHHHcCCcEEEEeccCCCCCCCCCCHHHHHHHHhhCCCc
Q 045794          445 VEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGFDMDLIKLISDAVSIP  524 (578)
Q Consensus       445 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~e~~~~~~~~G~~~ii~tdi~~dG~~~G~d~~li~~l~~~~~ip  524 (578)
                      ..+.++++.+.+++|+.+.||+|+++||++.+++++++|+++++++|+++|++|++++|||++|+|+++++.+++.+++|
T Consensus       405 ~~~~~~~~~~~~~~~~~~~~~~v~~~gg~~~~~~~~~~~~~~~~~~Gageil~t~id~DGt~~G~d~~l~~~v~~~~~ip  484 (538)
T PLN02617        405 VPFKTVKVTNPGPNGEEYAWYQCTVKGGREGRPIGAYELAKAVEELGAGEILLNCIDCDGQGKGFDIELVKLVSDAVTIP  484 (538)
T ss_pred             cccccccccccCcCcccceEEEEEEecCcccCCCCHHHHHHHHHhcCCCEEEEeeccccccccCcCHHHHHHHHhhCCCC
Confidence            45556666665666766778999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecCCCCHHHHHHHHHhcCchHHhhhhhhccCCCCHHHHHHHHHhCCCeecC
Q 045794          525 VIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI  578 (578)
Q Consensus       525 VIasGGi~s~eDi~~l~~~~G~~gv~vgsa~~~~~~~~~~~~~~l~~~~i~v~~  578 (578)
                      ||||||+++++|+.++++..|+++++.|+.||++++++.++|++|+++||+||+
T Consensus       485 viasGG~g~~~d~~~~~~~~~~~a~~aa~~fh~~~~~~~~~k~~l~~~gi~vr~  538 (538)
T PLN02617        485 VIASSGAGTPEHFSDVFSKTNASAALAAGIFHRKEVPISSVKEHLLEEGIETRI  538 (538)
T ss_pred             EEEECCCCCHHHHHHHHhcCCccEEEEEeeeccCCCCHHHHHHHHHHCCCccCC
Confidence            999999999999999998788999999999999999999999999999999985

>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>KOG3055 consensus Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>KOG1436 consensus Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>TIGR00381 cdhD CO dehydrogenase/acetyl-CoA synthase, delta subunit Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
1ox4_A555 Towards Understanding The Mechanism Of The Complex 1e-150
1jvn_A555 Crystal Structure Of Imidazole Glycerol Phosphate S 1e-149
1h5y_A253 Hisf Protein From Pyrobaculum Aerophilum Length = 2 5e-42
1ka9_F252 Imidazole Glycerol Phosphate Synthase Length = 252 2e-36
2a0n_A265 Crystal Structure Of Imidazole Glycerol Phosphate S 5e-36
1thf_D253 Cyclase Subunit Of Imidazoleglycerolphosphate Synth 5e-36
2wjz_A253 Crystal Structure Of (Hish) K181a Y138a Mutant Of I 6e-36
1vh7_A265 Crystal Structure Of A Cyclase Subunit Of Imidazolg 6e-36
1gpw_A253 Structural Evidence For Ammonia Tunneling Across Th 2e-35
4ewn_D253 Structure Of Hisf-D130v+d176v With Bound Rcdrp Leng 6e-34
2rkx_A255 The 3d Structure Of Chain D, Cyclase Subunit Of Imi 9e-33
1ka9_H200 Imidazole Glycerol Phosphate Synthase Length = 200 6e-32
3iio_A262 Evolutionary Optimization Of Computationally Design 1e-31
3iip_A256 Evolutionary Optimization Of Computationally Design 1e-31
3iiv_A263 Evolutionary Optimization Of Computationally Design 1e-31
4gud_A211 Crystal Structure Of Amidotransferase Hish From Vib 2e-29
1gpw_B201 Structural Evidence For Ammonia Tunneling Across Th 4e-24
1kxj_A205 The Crystal Structure Of Glutamine Amidotransferase 6e-24
2wjz_B201 Crystal Structure Of (Hish) K181a Y138a Mutant Of I 3e-22
3cwo_X237 A BetaALPHA-Barrel Built By The Combination Of Frag 8e-18
2w6r_A 266 Crystal Structure Of An Artificial (Ba)8-Barrel Pro 9e-17
3og3_A251 Crystal Structure Of An Artificial Thermostable (Ba 3e-16
3tdn_B247 Computationally Designed Two-Fold Symmetric Tim-Bar 2e-15
2lle_A234 Computational Design Of An Eight-Stranded (BetaALPH 3e-15
3tdm_A126 Computationally Designed Tim-Barrel Protein, Halffl 1e-10
4gj1_A243 Crystal Structure Of 1-(5-Phosphoribosyl)-5-[(5-Pho 2e-05
2iss_D208 Structure Of The Plp Synthase Holoenzyme From Therm 4e-05
2ywj_A186 Crystal Structure Of Uncharacterized Conserved Prot 3e-04
>pdb|1OX4|A Chain A, Towards Understanding The Mechanism Of The Complex Cyclization Reaction Catalyzed By Imidazole Glycerophosphate Synthase Length = 555 Back     alignment and structure 
Iteration: 1

 Score =  529 bits (1362), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 278/549 (50%), Positives = 365/549 (66%), Gaps = 21/549 (3%)
Query: 49  VVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPED--ILNANRLIFPGVGAFAAAMDVLNK 106
           VV ++D  +GN++S+ NAI HLG+ ++ V++P+D  I   +RLI PGVG +   +D L  
Sbjct: 6   VVHVIDVESGNLQSLTNAIEHLGYEVQLVKSPKDFNISGTSRLILPGVGNYGHFVDNLFN 65
Query: 107 TGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQ 166
            G  + +  YIE  +P +GIC+GLQ LF  S E+    GL  I   + RFD S    VP+
Sbjct: 66  RGFEKPIREYIESGKPIMGICVGLQALFAGSVESPKSTGLNYIDFKLSRFDDSEK-PVPE 124
Query: 167 IGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDDNKE------WVSSTCNYG-DNFIA 219
           IGWN+  I  ++           YFVHS+ A+ + + K+      W  +   YG + FIA
Sbjct: 125 IGWNSC-IPSENLFFGLDPYKRYYFVHSFAAILNSEKKKNLENDGWKIAKAKYGSEEFIA 183
Query: 220 SVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTN-IPKKPTEGKAL--------KLAKRV 270
           +V + N+ A QFHPEKSG  GL+V+  FL  ++  IP    E K L         L +R+
Sbjct: 184 AVNKNNIFATQFHPEKSGKAGLNVIENFLKQQSPPIPNYSAEEKELLMNDYSNYGLTRRI 243
Query: 271 IACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNIT 330
           IACLDVR ND+GDLVVTKGDQYDVRE +    VRNLGKPV+LA++YY++GADE++FLNIT
Sbjct: 244 IACLDVRTNDQGDLVVTKGDQYDVREKSDGKGVRNLGKPVQLAQKYYQQGADEVTFLNIT 303
Query: 331 GFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADK 390
            FRD PL D PML+VL+  ++ VFVPLTVGGGI+D  D +G    +LEVAS YFRSGADK
Sbjct: 304 SFRDCPLKDTPMLEVLKQAAKTVFVPLTVGGGIKDIVDVDGTKIPALEVASLYFRSGADK 363
Query: 391 ISIGSDAVYAAEDYLKTGVK-TGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFKA 449
           +SIG+DAVYAAE Y + G +  G S +E IS+ YG QAVV+S+DP+RVY+    D + K 
Sbjct: 364 VSIGTDAVYAAEKYYELGNRGDGTSPIETISKAYGAQAVVISVDPKRVYVNSQADTKNKV 423
Query: 450 VRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKGF 509
                 GPNGE+Y WYQCT+ GGRE R +G +EL +A E LGAGEILLNCID DG   G+
Sbjct: 424 FETEYPGPNGEKYCWYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSGY 483
Query: 510 DMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHL 569
           D++LI+ + DAV IPVIASSGAG  EHF + F KT A A L AG+FHR E  +  VKE+L
Sbjct: 484 DLELIEHVKDAVKIPVIASSGAGVPEHFEEAFLKTRADACLGAGMFHRGEFTVNDVKEYL 543
Query: 570 YKEGIEVRI 578
            + G++VR+
Sbjct: 544 LEHGLKVRM 552
>pdb|1JVN|A Chain A, Crystal Structure Of Imidazole Glycerol Phosphate Synthase: A Tunnel Through A (BetaALPHA)8 BARREL JOINS TWO ACTIVE SITES Length = 555 Back     alignment and structure
>pdb|1H5Y|A Chain A, Hisf Protein From Pyrobaculum Aerophilum Length = 253 Back     alignment and structure
>pdb|1KA9|F Chain F, Imidazole Glycerol Phosphate Synthase Length = 252 Back     alignment and structure
>pdb|2A0N|A Chain A, Crystal Structure Of Imidazole Glycerol Phosphate Synthase Subunit Hisf (ec 4.1.3.-) (tm1036) From Thermotoga Maritima At 1.64 A Resolution Length = 265 Back     alignment and structure
>pdb|1THF|D Chain D, Cyclase Subunit Of Imidazoleglycerolphosphate Synthase From Thermotoga Maritima Length = 253 Back     alignment and structure
>pdb|2WJZ|A Chain A, Crystal Structure Of (Hish) K181a Y138a Mutant Of Imidazoleglycerolphosphate Synthase (Hish Hisf) Which Displays Constitutive Glutaminase Activity Length = 253 Back     alignment and structure
>pdb|1VH7|A Chain A, Crystal Structure Of A Cyclase Subunit Of Imidazolglycerolphosphate Synthase Length = 265 Back     alignment and structure
>pdb|1GPW|A Chain A, Structural Evidence For Ammonia Tunneling Across The (BetaALPHA)8 BARREL OF THE IMIDAZOLE GLYCEROL PHOSPHATE Synthase Bienzyme Complex. Length = 253 Back     alignment and structure
>pdb|4EWN|D Chain D, Structure Of Hisf-D130v+d176v With Bound Rcdrp Length = 253 Back     alignment and structure
>pdb|2RKX|A Chain A, The 3d Structure Of Chain D, Cyclase Subunit Of Imidazoleglycerol_evolvedcerolphosphate Synthase Length = 255 Back     alignment and structure
>pdb|1KA9|H Chain H, Imidazole Glycerol Phosphate Synthase Length = 200 Back     alignment and structure
>pdb|3IIO|A Chain A, Evolutionary Optimization Of Computationally Designed Enzymes: Kemp Eliminases Of The Ke07 Series Length = 262 Back     alignment and structure
>pdb|3IIP|A Chain A, Evolutionary Optimization Of Computationally Designed Enzymes: Kemp Eliminases Of The Ke07 Series Length = 256 Back     alignment and structure
>pdb|3IIV|A Chain A, Evolutionary Optimization Of Computationally Designed Enzymes: Kemp Eliminases Of The Ke07 Series Length = 263 Back     alignment and structure
>pdb|4GUD|A Chain A, Crystal Structure Of Amidotransferase Hish From Vibrio Cholerae Length = 211 Back     alignment and structure
>pdb|1GPW|B Chain B, Structural Evidence For Ammonia Tunneling Across The (BetaALPHA)8 BARREL OF THE IMIDAZOLE GLYCEROL PHOSPHATE Synthase Bienzyme Complex. Length = 201 Back     alignment and structure
>pdb|1KXJ|A Chain A, The Crystal Structure Of Glutamine Amidotransferase From Thermotoga Maritima Length = 205 Back     alignment and structure
>pdb|2WJZ|B Chain B, Crystal Structure Of (Hish) K181a Y138a Mutant Of Imidazoleglycerolphosphate Synthase (Hish Hisf) Which Displays Constitutive Glutaminase Activity Length = 201 Back     alignment and structure
>pdb|3CWO|X Chain X, A BetaALPHA-Barrel Built By The Combination Of Fragments From Different Folds Length = 237 Back     alignment and structure
>pdb|2W6R|A Chain A, Crystal Structure Of An Artificial (Ba)8-Barrel Protein Designed From Identical Half Barrels Length = 266 Back     alignment and structure
>pdb|3OG3|A Chain A, Crystal Structure Of An Artificial Thermostable (Ba)8-Barrel Protein From Identical Half Barrels Length = 251 Back     alignment and structure
>pdb|3TDN|B Chain B, Computationally Designed Two-Fold Symmetric Tim-Barrel Protein, Flr Length = 247 Back     alignment and structure
>pdb|2LLE|A Chain A, Computational Design Of An Eight-Stranded (BetaALPHA)-Barrel From Fragments Of Different Folds Length = 234 Back     alignment and structure
>pdb|3TDM|A Chain A, Computationally Designed Tim-Barrel Protein, Halfflr Length = 126 Back     alignment and structure
>pdb|4GJ1|A Chain A, Crystal Structure Of 1-(5-Phosphoribosyl)-5-[(5-Phosphoribosylamino) Methylideneamino] Imidazole-4-Carboxamide Isomerase (Hisa) Length = 243 Back     alignment and structure
>pdb|2ISS|D Chain D, Structure Of The Plp Synthase Holoenzyme From Thermotoga Maritima Length = 208 Back     alignment and structure
>pdb|2YWJ|A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Methanocaldococcus Jannaschii Length = 186 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 0.0
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 1e-98
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 2e-92
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 3e-88
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 1e-85
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 3e-85
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 6e-83
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 4e-75
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 2e-63
3tdn_A 247 FLR symmetric alpha-beta TIM barrel; symmetric sup 2e-09
1q7r_A219 Predicted amidotransferase; structural genomics, Y 1e-51
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 1e-51
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 2e-45
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 4e-45
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 2e-41
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 2e-27
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 6e-24
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 2e-13
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 1e-12
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 2e-12
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 2e-06
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 1e-05
3m3p_A250 Glutamine amido transferase; structural genomics, 3e-05
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 1e-04
3l7n_A236 Putative uncharacterized protein; glutamine amidot 2e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 5e-04
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Length = 555 Back     alignment and structure
 Score =  772 bits (1995), Expect = 0.0
 Identities = 272/550 (49%), Positives = 358/550 (65%), Gaps = 21/550 (3%)

Query: 48  SVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPED--ILNANRLIFPGVGAFAAAMDVLN 105
            VV ++D  +GN++S+ NAI HLG+ ++ V++P+D  I   +RLI PGVG +   +D L 
Sbjct: 5   PVVHVIDVESGNLQSLTNAIEHLGYEVQLVKSPKDFNISGTSRLILPGVGNYGHFVDNLF 64

Query: 106 KTGMAEALCAYIEKDRPFLGICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVP 165
             G  + +  YIE  +P +GI +GLQ LF  S E+    GL  I   + RFD S    VP
Sbjct: 65  NRGFEKPIREYIESGKPIMGIXVGLQALFAGSVESPKSTGLNYIDFKLSRFDDSEK-PVP 123

Query: 166 QIGWNALQITKDSEILDDVGDHHVYFVHSYRAMPSDD------NKEWVSSTCNYGD-NFI 218
           +IGWN+   +++     D      YFVHS+ A+ + +      N  W  +   YG   FI
Sbjct: 124 EIGWNSCIPSENLFFGLD-PYKRYYFVHSFAAILNSEKKKNLENDGWKIAKAKYGSEEFI 182

Query: 219 ASVRRGNVHAVQFHPEKSGDVGLSVLRRFL---------HPKTNIPKKPTEGKALKLAKR 269
           A+V + N+ A QFHPEKSG  GL+V+  FL         +          +     L +R
Sbjct: 183 AAVNKNNIFATQFHPEKSGKAGLNVIENFLKQQSPPIPNYSAEEKELLMNDYSNYGLTRR 242

Query: 270 VIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNI 329
           +IACLDVR ND+GDLVVTKGDQYDVRE +    VRNLGKPV+LA++YY++GADE++FLNI
Sbjct: 243 IIACLDVRTNDQGDLVVTKGDQYDVREKSDGKGVRNLGKPVQLAQKYYQQGADEVTFLNI 302

Query: 330 TGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGAD 389
           T FRD PL D PML+VL+  ++ VFVPLTVGGGI+D  D +G    +LEVAS YFRSGAD
Sbjct: 303 TSFRDCPLKDTPMLEVLKQAAKTVFVPLTVGGGIKDIVDVDGTKIPALEVASLYFRSGAD 362

Query: 390 KISIGSDAVYAAEDYLKTGVK-TGKSSLEQISRVYGNQAVVVSIDPRRVYITHPNDVEFK 448
           K+SIG+DAVYAAE Y + G +  G S +E IS+ YG QAVV+S+DP+RVY+    D + K
Sbjct: 363 KVSIGTDAVYAAEKYYELGNRGDGTSPIETISKAYGAQAVVISVDPKRVYVNSQADTKNK 422

Query: 449 AVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQGKG 508
                  GPNGE+Y WYQCT+ GGRE R +G +EL +A E LGAGEILLNCID DG   G
Sbjct: 423 VFETEYPGPNGEKYCWYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSG 482

Query: 509 FDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEH 568
           +D++LI+ + DAV IPVIASSGAG  EHF + F KT A A L AG+FHR E  +  VKE+
Sbjct: 483 YDLELIEHVKDAVKIPVIASSGAGVPEHFEEAFLKTRADACLGAGMFHRGEFTVNDVKEY 542

Query: 569 LYKEGIEVRI 578
           L + G++VR+
Sbjct: 543 LLEHGLKVRM 552
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Length = 200 Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Length = 201 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Length = 253 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Length = 252 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Length = 253 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Length = 266 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Length = 237 Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Length = 247 Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Length = 219 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Length = 196 Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Length = 208 Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Length = 186 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Length = 191 Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Length = 227 Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Length = 260 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Length = 244 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Length = 244 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Length = 241 Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Length = 645 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189 Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Length = 250 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Length = 236 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query578
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 100.0
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 100.0
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 100.0
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 100.0
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 100.0
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 100.0
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 100.0
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 100.0
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 100.0
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 100.0
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.98
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 99.97
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.96
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.96
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 99.92
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 99.92
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 99.92
2a9v_A212 GMP synthase; structural genomics, joint center fo 99.92
3tqi_A527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.91
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.91
3uow_A556 GMP synthetase; structural genomics consortium, SG 99.91
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.9
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.9
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.9
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.9
1i1q_B192 Anthranilate synthase component II; tryptophan bio 99.9
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.9
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.89
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine ami 99.89
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.89
3l7n_A236 Putative uncharacterized protein; glutamine amidot 99.88
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 99.88
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 99.88
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.88
3m3p_A250 Glutamine amido transferase; structural genomics, 99.88
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.87
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 99.86
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.82
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.8
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.79
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 99.78
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.75
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.74
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 99.74
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 99.72
3tdn_A 247 FLR symmetric alpha-beta TIM barrel; symmetric sup 99.65
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.65
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 99.65
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 99.63
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 99.62
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 99.6
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.58
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.56
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 99.45
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 99.44
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 99.41
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 99.4
2w6r_A 266 Imidazole glycerol phosphate synthase subunit HISF 99.33
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 99.3
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 99.28
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 99.28
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 99.27
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 99.25
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 99.19
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 99.15
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 99.15
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 99.11
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 99.09
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 99.06
1qo2_A 241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 99.05
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 99.03
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 99.01
4gj1_A 243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.98
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 98.97
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.97
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 98.93
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 98.91
1ka9_F 252 Imidazole glycerol phosphtate synthase; riken stru 98.9
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 98.89
1thf_D 253 HISF protein; thermophIle, TIM-barrel, histidine b 98.86
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 98.84
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 98.84
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 98.83
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 98.82
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.82
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 98.81
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 98.8
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 98.78
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 98.76
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 98.75
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.72
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 98.72
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 98.71
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 98.71
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.69
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 98.67
1viz_A240 PCRB protein homolog; structural genomics, unknown 98.67
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 98.67
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.65
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 98.64
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 98.62
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 98.61
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 98.6
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 98.6
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 98.59
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.59
1viz_A240 PCRB protein homolog; structural genomics, unknown 98.56
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 98.55
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 98.54
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 98.53
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 98.53
1h5y_A 253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.52
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 98.51
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 98.49
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.46
1ujp_A271 Tryptophan synthase alpha chain; riken structural 98.45
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 98.45
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 98.44
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 98.43
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 98.41
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 98.4
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 98.4
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 98.38
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 98.38
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 98.36
3tha_A252 Tryptophan synthase alpha chain; structural genomi 98.36
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 98.35
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 98.34
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 98.34
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 98.34
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 98.33
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 98.33
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 98.31
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 98.3
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 98.29
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 98.29
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 98.29
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.28
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 98.28
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 98.28
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 98.27
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 98.26
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 98.26
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 98.26
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 98.25
2y88_A 244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.23
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 98.22
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 98.21
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.16
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 98.15
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 98.15
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 98.15
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 98.14
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 98.14
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 98.12
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 98.07
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 98.05
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 98.04
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 98.03
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 98.03
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 98.02
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 98.01
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 98.0
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 98.0
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 97.99
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 97.96
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 97.94
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 97.93
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 97.93
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 97.91
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 97.91
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 97.9
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 97.89
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 97.89
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 97.88
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.88
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 97.87
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.84
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 97.84
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 97.83
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 97.74
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 97.73
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 97.73
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 97.71
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 97.68
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 97.68
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 97.66
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 97.65
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 97.64
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 97.64
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 97.63
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 97.63
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 97.6
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 97.54
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 97.54
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.54
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 97.54
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 97.47
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 97.46
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 97.46
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 97.45
3cne_A175 Putative protease I; structural genomics, PSI-2, M 97.45
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 97.44
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.42
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 97.42
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 97.41
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 97.4
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.38
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 97.36
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.36
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.35
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 97.34
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 97.3
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 97.3
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 97.29
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 97.28
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 97.26
2fex_A188 Conserved hypothetical protein; structural genomic 97.26
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 97.26
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 97.23
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 97.23
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 97.22
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.21
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 97.2
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 97.19
3er6_A209 Putative transcriptional regulator protein; struct 97.19
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 97.18
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 97.17
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 97.15
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 97.14
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 97.12
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 97.09
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 97.08
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 97.06
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 97.04
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 97.04
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 97.04
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 97.03
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 97.02
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 97.0
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 96.98
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 96.97
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 96.95
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 96.94
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 96.93
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 96.92
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 96.92
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 96.87
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 96.86
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 96.84
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 96.78
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 96.76
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 96.76
1ujp_A271 Tryptophan synthase alpha chain; riken structural 96.75
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 96.75
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 96.75
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 96.73
3kts_A192 Glycerol uptake operon antiterminator regulatory; 96.71
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 96.69
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 96.66
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 96.65
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 96.64
3tha_A252 Tryptophan synthase alpha chain; structural genomi 96.63
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 96.63
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 96.62
3en0_A291 Cyanophycinase; serine protease, beta peptide spec 96.62
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 96.6
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 96.58
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 96.58
2qgy_A391 Enolase from the environmental genome shotgun sequ 96.57
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 96.57
3rr1_A 405 GALD, putative D-galactonate dehydratase; enolase, 96.55
3eez_A378 Putative mandelate racemase/muconate lactonizing e 96.54
3mgk_A211 Intracellular protease/amidase related enzyme (THI 96.5
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 96.5
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.49
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 96.48
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 96.46
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 96.46
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 96.45
3kts_A192 Glycerol uptake operon antiterminator regulatory; 96.45
3gra_A202 Transcriptional regulator, ARAC family; transcript 96.45
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 96.42
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 96.41
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 96.4
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 96.38
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 96.37
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 96.36
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 96.36
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 96.35
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 96.34
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 96.32
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 96.31
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 96.31
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 96.3
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 96.28
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 96.27
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 96.27
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 96.27
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 96.26
1u9c_A224 APC35852; structural genomics, protein structure i 96.25
2oz8_A389 MLL7089 protein; structural genomics, unknown func 96.24
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.24
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 96.23
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 96.22
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 96.22
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 96.2
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 96.2
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 96.19
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 96.18
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 96.18
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 96.17
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 96.16
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.14
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 96.13
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 96.13
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 96.13
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 96.11
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 96.11
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 96.11
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 96.11
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 96.09
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 96.07
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 96.06
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 96.04
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 96.04
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 96.04
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 96.04
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 96.03
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 96.02
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 96.02
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 96.01
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 96.01
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 96.0
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 95.99
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 95.97
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 95.96
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 95.95
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 95.95
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 95.94
3n7t_A247 Macrophage binding protein; seattle structural gen 95.92
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 95.92
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 95.9
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 95.88
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 95.88
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 95.88
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 95.86
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 95.86
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 95.85
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 95.84
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 95.8
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 95.8
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 95.78
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 95.76
3oa3_A288 Aldolase; structural genomics, seattle structural 95.75
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 95.75
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 95.74
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 95.73
1tzz_A392 Hypothetical protein L1841; structural genomics, m 95.73
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 95.71
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 95.71
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 95.71
3r0u_A379 Enzyme of enolase superfamily; structural genomics 95.64
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 95.64
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 95.6
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 95.57
3rcy_A 433 Mandelate racemase/muconate lactonizing enzyme-LI 95.56
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 95.56
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 95.53
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 95.53
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 95.52
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 95.5
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 95.5
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 95.49
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 95.49
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 95.48
2poz_A392 Putative dehydratase; octamer, structural genomics 95.48
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 95.47
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 95.46
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 95.44
2qr6_A 393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 95.43
2qde_A 397 Mandelate racemase/muconate lactonizing enzyme FA 95.41
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 95.39
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 95.38
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 95.37
2gl5_A410 Putative dehydratase protein; structural genomics, 95.36
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 95.36
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 95.36
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 95.36
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 95.36
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 95.32
2o56_A407 Putative mandelate racemase; dehydratase, structur 95.28
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 95.28
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 95.27
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 95.26
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 95.22
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 95.22
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 95.21
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 95.21
4e4u_A 412 Mandalate racemase/muconate lactonizing enzyme; ma 95.2
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 95.19
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 95.15
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 95.14
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 95.07
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 95.07
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 95.07
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 95.04
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 95.0
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 94.98
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 94.97
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 94.94
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 94.91
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 94.9
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 94.89
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 94.88
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 94.86
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 94.84
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 94.82
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 94.76
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 94.76
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 94.68
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 94.6
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 94.59
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 94.52
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 94.48
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 94.39
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 94.28
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 94.24
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 94.21
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 94.2
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 94.14
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 94.05
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 94.03
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 93.99
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 93.81
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 93.75
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 93.64
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 93.61
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 93.55
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 93.51
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 93.43
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 93.38
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 93.32
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 93.24
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 93.21
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 93.04
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 93.01
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 92.98
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 92.85
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 92.8
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 92.64
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 92.51
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 92.48
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 92.46
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 92.39
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 92.38
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 92.37
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 92.26
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 92.14
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 92.07
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 92.04
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 92.04
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 92.02
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 91.94
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 91.88
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 91.83
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 91.78
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 91.62
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 91.47
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 91.38
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 91.02
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 90.98
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 90.97
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 90.95
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 90.3
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 90.2
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 90.03
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 90.01
3oa3_A288 Aldolase; structural genomics, seattle structural 89.99
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 89.73
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 89.66
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 89.66
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 89.36
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 89.3
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 89.19
3luf_A259 Two-component system response regulator/ggdef doma 89.18
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 89.17
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 88.93
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 88.93
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 88.82
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 88.73
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 88.7
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 88.46
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 88.41
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 88.16
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 88.09
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 88.08
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 87.9
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 87.83
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 87.68
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
Probab=100.00  E-value=2e-87  Score=744.14  Aligned_cols=529  Identities=51%  Similarity=0.890  Sum_probs=438.0

Q ss_pred             CcEEEEEECCCCCHHHHHHHHHHCCCeEEEeCCccC--CCCCCEEEECCCCCchHHHHHHHhhcHHHHHHHHHhCCCCEE
Q 045794           47 DSVVTLLDYGAGNVRSVRNAIRHLGFGIKDVQTPED--ILNANRLIFPGVGAFAAAMDVLNKTGMAEALCAYIEKDRPFL  124 (578)
Q Consensus        47 ~~~I~vld~~~g~~~~i~~~L~~~Gv~v~~v~~~~d--l~~~DGlILpGGg~~~~~~~~l~~~~l~~~i~~~~~~g~PIl  124 (578)
                      .++|+|+|++++++.++.++|+++|+++.+++.+++  +.++||||||||+++......+....+.+.++++++.++|+|
T Consensus         4 m~~I~Iid~~~g~~~~~~~~l~~~G~~~~vv~~~~~~~l~~~DglILpGgG~~~~~~~~l~~~~~~~~i~~~~~~g~PiL   83 (555)
T 1jvn_A            4 MPVVHVIDVESGNLQSLTNAIEHLGYEVQLVKSPKDFNISGTSRLILPGVGNYGHFVDNLFNRGFEKPIREYIESGKPIM   83 (555)
T ss_dssp             SCEEEEECCSCSCCHHHHHHHHHTTCEEEEESSGGGCCSTTCSCEEEEECSCHHHHHHHHHHTTCHHHHHHHHHTTCCEE
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHCCCEEEEECCccccccccCCEEEECCCCchHhHhhhhhhccHHHHHHHHHHcCCcEE
Confidence            367999999888999999999999999999988777  889999999998776655555555567889999999999999


Q ss_pred             EEechHHHHhhhcccCCCcCCCcccCceeeeecCCCCCCcceeeeEEEEEccCCcccccCC-CeEEEEEeeeeeecCCC-
Q 045794          125 GICLGLQLLFQSSEENGPVNGLGLIPGVVGRFDSSNGFRVPQIGWNALQITKDSEILDDVG-DHHVYFVHSYRAMPSDD-  202 (578)
Q Consensus       125 GIClG~QlLa~a~~e~~~~~Glgl~~~~v~~~~~~~~~~~~~~G~~~i~~~~~~~l~~~l~-~~~~~~~H~~~v~~~~~-  202 (578)
                      |||+|||+|+.++.+++.+.++|++++++.++... ..+.+++||+++.++  ++++..++ .+.++++|+++++..+. 
T Consensus        84 GIC~G~QlL~~a~~egg~~~~Lg~lgg~v~~~~~~-~~~~~~~G~~~v~~~--~~L~~~l~~~~~~~~vHS~~~~~i~~~  160 (555)
T 1jvn_A           84 GIXVGLQALFAGSVESPKSTGLNYIDFKLSRFDDS-EKPVPEIGWNSCIPS--ENLFFGLDPYKRYYFVHSFAAILNSEK  160 (555)
T ss_dssp             EEEHHHHTTEEEETTBTTCCCCCSEEEEEEECCTT-TSCSSEEEEECCCCC--TTCCTTCCTTSCEEEEESEECBCCHHH
T ss_pred             EEchhhhhhhhhhhcCCCccccCCCCcEEEECCcC-CCCCccccceEEEEc--CHHHhhCCCCceEEEEEEEEEEecccc
Confidence            99999999999887766688999999999875421 235688999988765  78888776 45788999999876432 


Q ss_pred             -----CCCcEEEEeecC-CceEEEEEeCCEEEEeeCCcccCcchHHHHHHHhhhccCCCC-------C--CCcccccccc
Q 045794          203 -----NKEWVSSTCNYG-DNFIASVRRGNVHAVQFHPEKSGDVGLSVLRRFLHPKTNIPK-------K--PTEGKALKLA  267 (578)
Q Consensus       203 -----~~~~~~~~~~~~-d~~iegi~~~~i~gvQFHPE~~~~~~~~l~~~Fl~~~~~~~~-------~--~~~~~~~~~~  267 (578)
                           ......+.+.++ ++++++++.+++||+|||||++...+..+|++|++.....-|       .  .+..+.+|+.
T Consensus       161 ~~~L~~g~~vlA~s~~~~D~~i~ai~~~~i~GvQFHPE~s~~~g~~l~~~Fl~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (555)
T 1jvn_A          161 KKNLENDGWKIAKAKYGSEEFIAAVNKNNIFATQFHPEKSGKAGLNVIENFLKQQSPPIPNYSAEEKELLMNDYSNYGLT  240 (555)
T ss_dssp             HHHHHHTTCEEEEEEETTEEEEEEEEETTEEEESSBGGGSHHHHHHHHHHHHTTCCCCCCCCCHHHHHHHSCCCGGGGCC
T ss_pred             cccCCCCCEEEEEEcCCCCCeEEEEEeCCEEEEEeCcEecChhHHHHHHHHHhcccccCCccccCCcccCCCCCCCccee
Confidence                 123455555555 478999999999999999999766678999999987631101       0  1234468999


Q ss_pred             eeEEEeeeEeecCCCCEEEEecceeeeeeccccccEEecCCHHHHHHHHHHcCCCeEEEEecccCCCCCCCCchhHHHHH
Q 045794          268 KRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDLPMLQVLR  347 (578)
Q Consensus       268 ~riIp~iDl~~~~~g~~v~~~G~~~~~~~~~~~~~~~~~~~p~~~a~~~~~~g~~~i~~~Dl~~~~~~~~~~~~~~~~i~  347 (578)
                      ||||||||++++++|+||++||.+|.+|++++....++.+||+++|+.|++.||++||++||++++++..++..++++|+
T Consensus       241 ~~iip~iD~~~g~~g~~V~~kg~~~~vr~~~g~~~~~~~~dp~~~A~~~~~~Ga~~l~~~dl~~~~~~~~~~~~~~~~i~  320 (555)
T 1jvn_A          241 RRIIACLDVRTNDQGDLVVTKGDQYDVREKSDGKGVRNLGKPVQLAQKYYQQGADEVTFLNITSFRDCPLKDTPMLEVLK  320 (555)
T ss_dssp             CCEEEEEEEEECTTSCEESSTTC---------------CHHHHHHHHHHHHTTCSEEEEEEEC---CCCGGGCHHHHHHH
T ss_pred             EEEEEEEEEecCCCCcEEEeccceeeEEecccccCceEcCCHHHHHHHHHHcCCCEEEEEeCCccccccCCCchHHHHHH
Confidence            99999999997766887777999988888877555666789999999999999999999999998765555678899999


Q ss_pred             HHhhhccccEEEeCCccccccCCCCccChHHHHHHHHHcCcceeecchhhhccchhhhhcc-ccCCchHHHHHHHhCCCC
Q 045794          348 LTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTG-VKTGKSSLEQISRVYGNQ  426 (578)
Q Consensus       348 ~i~~~~~~pi~~gGGir~~~d~~~~~~~~~~~~~~~l~~Ga~~vv~gt~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~  426 (578)
                      ++++++++||++|||||+.+|.+|||||++|++++++++||++|+|||.+++++..+.+.+ .+++|+++++++++||+|
T Consensus       321 ~i~~~~~ipi~vgGGIr~~~d~~~~~~~~~~~a~~~l~aGad~V~igt~~~~~~~~~~~~~~~~~~~~~i~~~~~~~g~~  400 (555)
T 1jvn_A          321 QAAKTVFVPLTVGGGIKDIVDVDGTKIPALEVASLYFRSGADKVSIGTDAVYAAEKYYELGNRGDGTSPIETISKAYGAQ  400 (555)
T ss_dssp             HHTTTCCSCEEEESSCSCEECTTCCEECHHHHHHHHHHHTCSEEEECHHHHHHHHHHHHTTSCCCSCSHHHHHHHHHCGG
T ss_pred             HHHhhCCCcEEEeCccccchhcccccchHHHHHHHHHHcCCCEEEECCHHhhCchhhccccccccCHHHHHHHHHHhCCC
Confidence            9999999999999999999999999999999999999999999999999998543343332 457899999999999999


Q ss_pred             eEEEEEeccccccCCCCccccceeeeccCCCCCCCcceEEEEEcccccCCCCCHHHHHHHHHHcCCcEEEEeccCCCCCC
Q 045794          427 AVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDCDGQG  506 (578)
Q Consensus       427 ~iv~slD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~e~~~~~~~~G~~~ii~tdi~~dG~~  506 (578)
                      +|++|||+|+.++..|.+..++++++...+++|+.|+||+|+++||.+.+++++.+++++++++|+++|++|++++||++
T Consensus       401 ~ivv~iD~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~v~~~Gw~~~~~~~~~e~a~~~~~~Ga~~il~t~~~~dG~~  480 (555)
T 1jvn_A          401 AVVISVDPKRVYVNSQADTKNKVFETEYPGPNGEKYCWYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSN  480 (555)
T ss_dssp             GEEEEECEEEEEESSGGGCSSCCEECSSCCTTCCCEEEEEEEETTTTEEEEEEHHHHHHHHHHTTCCEEEECCGGGTTTC
T ss_pred             cEEEEEEccccccccccccccccccccccCCCCCcceeEEEEEecCccCCCCCHHHHHHHHHHcCCCEEEEeCCCCCCCC
Confidence            99999999976544444445667777777888877889999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHhhCCCcEEEecCCCCHHHHHHHHHhcCchHHhhhhhhccCCCCHHHHHHHHHhCCCeecC
Q 045794          507 KGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI  578 (578)
Q Consensus       507 ~G~d~~li~~l~~~~~ipVIasGGi~s~eDi~~l~~~~G~~gv~vgsa~~~~~~~~~~~~~~l~~~~i~v~~  578 (578)
                      +|+|+++++++++.+++||||+|||++++|++++++.+||+||++|+++|.+++++++++++|+++||+||+
T Consensus       481 ~G~d~~li~~l~~~~~iPVIasGGi~s~~d~~~~~~~~G~~gvivg~a~~~~~~~~~e~~~~l~~~gi~~r~  552 (555)
T 1jvn_A          481 SGYDLELIEHVKDAVKIPVIASSGAGVPEHFEEAFLKTRADACLGAGMFHRGEFTVNDVKEYLLEHGLKVRM  552 (555)
T ss_dssp             SCCCHHHHHHHHHHCSSCEEECSCCCSHHHHHHHHHHSCCSEEEESHHHHTTSCCHHHHHHHHHHTTCCCCC
T ss_pred             CCCCHHHHHHHHHhCCccEEEECCCCCHHHHHHHHHhcCChHHHHHHHHHcCCCCHHHHHHHHHHCCCcccc
Confidence            999999999999999999999999999999999996589999999999999999999999999999999984
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 578
d1jvna1323 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of 2e-87
d1h5ya_252 c.1.2.1 (A:) Cyclase subunit (or domain) of imidaz 9e-50
d1ka9f_251 c.1.2.1 (F:) Cyclase subunit (or domain) of imidaz 5e-43
d1jvna2232 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain 7e-40
d1thfd_253 c.1.2.1 (D:) Cyclase subunit (or domain) of imidaz 2e-39
d2abwa1218 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protei 2e-37
d1k9vf_200 c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i 1e-34
d1ka9h_195 c.23.16.1 (H:) GAT subunit, HisH, (or domain) of i 1e-31
d2nv0a1195 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bac 3e-29
d1q7ra_202 c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus 2e-27
d1vzwa1239 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoi 1e-18
d2a9va1196 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA 3e-11
d1qo2a_241 c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidaz 4e-10
d1qo2a_241 c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidaz 1e-04
d1gpma2205 c.23.16.1 (A:3-207) GMP synthetase {Escherichia co 8e-10
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 1e-08
d1wl8a1188 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA 3e-08
d1l9xa_288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 9e-08
d1qdlb_195 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 8e-07
d1o1ya_230 c.23.16.1 (A:) Hypothetical protein TM1158 {Thermo 8e-06
d1i7qb_192 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 8e-04
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 323 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: Histidine biosynthesis enzymes
domain: Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF
species: Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]

 Score =  272 bits (695), Expect = 2e-87
 Identities = 189/316 (59%), Positives = 236/316 (74%), Gaps = 1/316 (0%)

Query: 264 LKLAKRVIACLDVRANDKGDLVVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADE 323
             L +R+IACLDVR ND+GDLVVTKGDQYDVRE +    VRNLGKPV+LA++YY++GADE
Sbjct: 5   YGLTRRIIACLDVRTNDQGDLVVTKGDQYDVREKSDGKGVRNLGKPVQLAQKYYQQGADE 64

Query: 324 ISFLNITGFRDFPLGDLPMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEY 383
           ++FLNIT FRD PL D PML+VL+  ++ VFVPLTVGGGI+D  D +G    +LEVAS Y
Sbjct: 65  VTFLNITSFRDCPLKDTPMLEVLKQAAKTVFVPLTVGGGIKDIVDVDGTKIPALEVASLY 124

Query: 384 FRSGADKISIGSDAVYAAEDYLKTGVKTGKSSL-EQISRVYGNQAVVVSIDPRRVYITHP 442
           FRSGADK+SIG+DAVYAAE Y + G +   +S  E IS+ YG QAVV+S+DP+RVY+   
Sbjct: 125 FRSGADKVSIGTDAVYAAEKYYELGNRGDGTSPIETISKAYGAQAVVISVDPKRVYVNSQ 184

Query: 443 NDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLNCIDC 502
            D + K       GPNGE+Y WYQCT+ GGRE R +G +EL +A E LGAGEILLNCID 
Sbjct: 185 ADTKNKVFETEYPGPNGEKYCWYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDK 244

Query: 503 DGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPI 562
           DG   G+D++LI+ + DAV IPVIASSGAG  EHF + F KT A A L AG+FHR E  +
Sbjct: 245 DGSNSGYDLELIEHVKDAVKIPVIASSGAGVPEHFEEAFLKTRADACLGAGMFHRGEFTV 304

Query: 563 QSVKEHLYKEGIEVRI 578
             VKE+L + G++VR+
Sbjct: 305 NDVKEYLLEHGLKVRM 320
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 252 Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 251 Back     information, alignment and structure
>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 232 Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 253 Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 218 Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200 Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 195 Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Length = 202 Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Length = 239 Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196 Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Length = 241 Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Length = 241 Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Length = 230 Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query578
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 100.0
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 100.0
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 100.0
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 100.0
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 100.0
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 100.0
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 99.97
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 99.96
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 99.95
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 99.95
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 99.94
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 99.93
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 99.93
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 99.93
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 99.92
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 99.92
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 99.91
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 99.9
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 99.88
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.74
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.71
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.66
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 99.25
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 99.23
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 99.13
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.09
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.97
d1h5ya_ 252 Cyclase subunit (or domain) of imidazoleglycerolph 98.9
d1thfd_ 253 Cyclase subunit (or domain) of imidazoleglycerolph 98.89
d1ka9f_ 251 Cyclase subunit (or domain) of imidazoleglycerolph 98.84
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 98.77
d1vzwa1 239 Phosphoribosylformimino-5-aminoimidazole carboxami 98.72
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 98.71
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 98.66
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 98.66
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 98.33
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 98.32
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 98.27
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 98.26
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 98.25
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 98.15
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 98.13
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 98.1
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 98.05
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 98.03
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 98.02
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 98.01
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 97.97
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 97.94
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 97.89
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 97.88
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 97.88
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 97.82
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 97.71
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 97.7
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.7
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 97.69
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 97.64
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 97.61
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 97.59
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 97.57
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 97.57
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 97.56
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 97.53
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 97.49
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 97.49
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 97.45
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 97.36
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 97.32
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 97.26
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 97.25
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 97.24
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 97.23
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 97.23
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 97.23
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 97.22
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 97.16
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 97.13
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 97.11
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 97.0
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 96.98
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 96.95
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 96.93
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 96.91
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 96.89
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 96.86
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 96.85
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 96.84
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 96.73
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 96.72
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 96.5
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 96.43
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 96.38
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.31
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 96.28
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 96.27
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 96.2
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 96.07
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 96.04
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 95.98
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 95.98
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 95.9
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 95.89
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 95.85
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 95.79
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 95.77
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 95.68
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 95.65
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 95.65
d1fyea_229 Aspartyl dipeptidase PepE {Salmonella typhimurium 95.51
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 95.41
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 95.38
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 95.33
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 95.28
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 95.23
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 95.22
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 95.15
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 95.04
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 94.89
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 94.75
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 94.67
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 94.67
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 94.65
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 94.63
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 94.54
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 94.52
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 94.5
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 94.44
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 94.44
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 94.43
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 94.29
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 94.26
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 94.26
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 94.24
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 94.24
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 94.16
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 94.13
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 93.92
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.82
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 93.61
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 93.57
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 93.57
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 93.47
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 93.39
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 93.29
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 93.23
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 93.1
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 93.09
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 93.06
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 92.81
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 92.63
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 92.58
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 92.4
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 92.4
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 92.01
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 91.54
d2qy9a2211 GTPase domain of the signal recognition particle r 91.36
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 91.33
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 91.2
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 91.2
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 91.01
d1okkd2207 GTPase domain of the signal recognition particle r 91.0
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 90.71
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 90.54
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 90.47
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 90.38
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 90.22
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 90.22
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 89.84
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 89.71
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 89.67
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 89.62
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 89.59
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 89.49
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 89.35
d1z0sa1249 Inorganic polyphosphate/ATP-NAD kinase PpnK {Archa 88.84
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 88.84
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 88.72
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 88.6
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 88.07
d1mxsa_ 216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 87.97
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 87.76
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 87.44
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 87.01
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 86.94
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 86.93
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 86.79
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 86.69
d1vmaa2213 GTPase domain of the signal recognition particle r 86.61
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 86.5
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 86.14
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 85.79
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 85.32
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 85.26
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 84.99
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 84.93
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 84.7
d3bofa1260 Cobalamin-dependent methionine synthase MetH, C-te 84.58
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 84.52
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 84.5
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 84.48
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 84.33
d1j8yf2211 GTPase domain of the signal sequence recognition p 84.19
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 83.87
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 83.52
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 83.5
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 83.31
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 82.42
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 82.33
d1qkka_140 Transcriptional regulatory protein DctD, receiver 82.2
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 82.13
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 81.95
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 81.48
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 81.22
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 80.66
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 80.65
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 80.61
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: Histidine biosynthesis enzymes
domain: Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF
species: Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]

Probab=100.00  E-value=2e-57  Score=464.33  Aligned_cols=311  Identities=59%  Similarity=0.992  Sum_probs=258.8

Q ss_pred             cccceeEEEeeeEeecCCCCE---EEEecceeeeeeccccccEEecCCHHHHHHHHHHcCCCeEEEEecccCCCCCCCCc
Q 045794          264 LKLAKRVIACLDVRANDKGDL---VVTKGDQYDVREHTKENEVRNLGKPVELARQYYKEGADEISFLNITGFRDFPLGDL  340 (578)
Q Consensus       264 ~~~~~riIp~iDl~~~~~g~~---v~~~G~~~~~~~~~~~~~~~~~~~p~~~a~~~~~~g~~~i~~~Dl~~~~~~~~~~~  340 (578)
                      .||++||||+||++   +|+|   +++||.+|+.+.+......+..|||+++|+.|+++||||||++||+|+.++...+.
T Consensus         5 ~~l~kRIIP~ldi~---~g~~~~~~l~Kg~~f~~~~~~~~~~~r~iGdP~~~a~~~~~~gaDeL~ivDidas~~~~~~~~   81 (323)
T d1jvna1           5 YGLTRRIIACLDVR---TNDQGDLVVTKGDQYDVREKSDGKGVRNLGKPVQLAQKYYQQGADEVTFLNITSFRDCPLKDT   81 (323)
T ss_dssp             GGCCCCEEEEEEEE---ECTTSCEESSTTC---------------CHHHHHHHHHHHHTTCSEEEEEEEC---CCCGGGC
T ss_pred             CCCCccEEEEEEEe---CCccceEEEEcCcccceeecccccCccccCCHHHHHHHHHHCCCCEEEEEECcCCCCCcCCCc
Confidence            68999999999999   7775   47899988754444445667789999999999999999999999999877655667


Q ss_pred             hhHHHHHHHhhhccccEEEeCCccccccCCCCccChHHHHHHHHHcCcceeecchhhhccchhhhhcc--ccCCchHHHH
Q 045794          341 PMLQVLRLTSENVFVPLTVGGGIRDFTDANGRHYSSLEVASEYFRSGADKISIGSDAVYAAEDYLKTG--VKTGKSSLEQ  418 (578)
Q Consensus       341 ~~~~~i~~i~~~~~~pi~~gGGir~~~d~~~~~~~~~~~~~~~l~~Ga~~vv~gt~~~~~~~~~~~~~--~~~~~~~l~~  418 (578)
                      .++++|+++++++++||++|||||+++|+++.--++.|.|++|+++|||||+|||+++++ |+|+.+-  .-.||.++++
T Consensus        82 ~~~~~I~~i~~~~~vPi~vGGGIrsi~di~~~~~~~~e~A~~ll~~GadKVvI~T~ai~~-p~~~~e~~~~~~n~~li~~  160 (323)
T d1jvna1          82 PMLEVLKQAAKTVFVPLTVGGGIKDIVDVDGTKIPALEVASLYFRSGADKVSIGTDAVYA-AEKYYELGNRGDGTSPIET  160 (323)
T ss_dssp             HHHHHHHHHTTTCCSCEEEESSCSCEECTTCCEECHHHHHHHHHHHTCSEEEECHHHHHH-HHHHHHTTSCCCSCSHHHH
T ss_pred             hHHHHHHhhccccceeEEEecCcccHHHhhhccchhhHHHHHHHHcCCCeEEechHHhhC-hHHHHHHHhhcccchhHHH
Confidence            889999999999999999999999999988887889999999999999999999999995 5665321  1147899999


Q ss_pred             HHHhCCCCeEEEEEeccccccCCCCccccceeeeccCCCCCCCcceEEEEEcccccCCCCCHHHHHHHHHHcCCcEEEEe
Q 045794          419 ISRVYGNQAVVVSIDPRRVYITHPNDVEFKAVRVTDLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEDLGAGEILLN  498 (578)
Q Consensus       419 ~~~~~g~~~iv~slD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~e~~~~~~~~G~~~ii~t  498 (578)
                      +++.||+|+|++|||++........+--.+.++.....++|+.+.||+|+++||++.+++++.+|++.++++|++||++|
T Consensus       161 i~~~fGsq~IvvsiD~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~v~~~gg~~~t~~~l~~~i~~~~~~G~GEIllt  240 (323)
T d1jvna1         161 ISKAYGAQAVVISVDPKRVYVNSQADTKNKVFETEYPGPNGEKYCWYQCTIKGGRESRDLGVWELTRACEALGAGEILLN  240 (323)
T ss_dssp             HHHHHCGGGEEEEECEEEEEESSGGGCSSCCEECSSCCTTCCCEEEEEEEETTTTEEEEEEHHHHHHHHHHTTCCEEEEC
T ss_pred             HHHHhCCceEEEEEEEEeccccccccccccccccccccCCCccceeEEEEEcCCeEecCchHHHHhhhhhccCcceeEEE
Confidence            99999999999999998642110000011223334445678888999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCCCHHHHHHHHhhCCCcEEEecCCCCHHHHHHHHHhcCchHHhhhhhhccCCCCHHHHHHHHHhCCCeecC
Q 045794          499 CIDCDGQGKGFDMDLIKLISDAVSIPVIASSGAGAVEHFSDVFRKTNASAALAAGIFHRKEVPIQSVKEHLYKEGIEVRI  578 (578)
Q Consensus       499 di~~dG~~~G~d~~li~~l~~~~~ipVIasGGi~s~eDi~~l~~~~G~~gv~vgsa~~~~~~~~~~~~~~l~~~~i~v~~  578 (578)
                      ++++|||++|+|+++++++.+.+++|||++||+++++|+.+++++.+++||++|++||++.+++.++|++|++++|+||+
T Consensus       241 dIdrDGt~~G~D~el~~~i~~~~~iPiIasGGi~s~~di~~ll~~~~v~gv~~gs~~~~~~~si~elK~~L~~~~i~vR~  320 (323)
T d1jvna1         241 CIDKDGSNSGYDLELIEHVKDAVKIPVIASSGAGVPEHFEEAFLKTRADACLGAGMFHRGEFTVNDVKEYLLEHGLKVRM  320 (323)
T ss_dssp             CGGGTTTCSCCCHHHHHHHHHHCSSCEEECSCCCSHHHHHHHHHHSCCSEEEESHHHHTTSCCHHHHHHHHHHTTCCCCC
T ss_pred             eecccccccccchhHHHHHHHhCCCCEEEECCCCCHHHHHHHHHhCCCeEEEEhhHHHcCCCCHHHHHHHHHHCCCccCC
Confidence            99999999999999999999999999999999999999999887789999999999999999999999999999999995
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure