Citrus Sinensis ID: 045807

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320

MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEEHAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISRELRRRLFGRSRRRRSRSRSRSRSPHKYRGGYEERSHGGGRGSGRRDDDRDHRLHGRGRRPRSRSPGRRGGRSRSPGARRRSPVRESSVERRAKIEQWNREKEQADSGNKVDNSSYNDDRNDDDRDGNGFTPNGGEYSDPQQH

cHHHHHHHHcccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccEEEEEccHHHHHHHHHHHcccccccCEEEEEEcccccccccEEEccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc

***HLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEEHAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISRELRR******************************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Splicing factor U2af small subunit B	Necessary for the splicing of pre-mRNA.	confident	Q9FMY5
Splicing factor U2af small subunit A	Necessary for the splicing of pre-mRNA.	probable	Q9ZQW8
Splicing factor U2af small subunit B	Necessary for the splicing of pre-mRNA.	probable	Q6AUG0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JMT, chain A
Confidence level:very confident
Coverage over the Query: 43-145
View the alignment between query and template
View the model in PyMOL

Template: 3U1L, chain A
Confidence level:confident
Coverage over the Query: 15-145
View the alignment between query and template
View the model in PyMOL