Citrus Sinensis ID: 045807
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 320 | ||||||
| 13278055 | 310 | CDNA sequence BC003883 [Mus musculus] | 0.962 | 0.993 | 0.819 | 1e-134 | |
| 356505320 | 314 | PREDICTED: splicing factor U2af small su | 0.940 | 0.958 | 0.765 | 1e-122 | |
| 255575357 | 313 | U2 snrnp auxiliary factor, small subunit | 0.965 | 0.987 | 0.743 | 1e-121 | |
| 356572520 | 314 | PREDICTED: splicing factor U2af small su | 0.940 | 0.958 | 0.752 | 1e-120 | |
| 294463000 | 334 | unknown [Picea sitchensis] | 0.912 | 0.874 | 0.716 | 1e-120 | |
| 449451104 | 317 | PREDICTED: splicing factor U2af small su | 0.890 | 0.899 | 0.872 | 1e-118 | |
| 449528561 | 317 | PREDICTED: splicing factor U2af small su | 0.890 | 0.899 | 0.872 | 1e-118 | |
| 449443402 | 326 | PREDICTED: splicing factor U2af small su | 0.871 | 0.855 | 0.790 | 1e-115 | |
| 255573032 | 322 | U2 snrnp auxiliary factor, small subunit | 0.981 | 0.975 | 0.732 | 1e-114 | |
| 388521171 | 327 | unknown [Medicago truncatula] | 0.906 | 0.886 | 0.736 | 1e-114 |
| >gi|13278055|gb|AAH03883.1| CDNA sequence BC003883 [Mus musculus] | Back alignment and taxonomy information |
|---|
Score = 484 bits (1246), Expect = e-134, Method: Compositional matrix adjust.
Identities = 263/321 (81%), Positives = 275/321 (85%), Gaps = 13/321 (4%)
Query: 1 MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP 60
MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLL+NMYQRPDMITP
Sbjct: 1 MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLANMYQRPDMITP 60
Query: 61 GVDPQGQALDPRKIQDHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE 120
GVDPQGQ LDPRKIQ HFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE
Sbjct: 61 GVDPQGQPLDPRKIQQHFEDFYEDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEE 120
Query: 121 HAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL 180
HA ALRNL+GRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL
Sbjct: 121 HAGEALRNLSGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKISREL 180
Query: 181 RRRLFGRSRRRRSRSRSRSRSPHKYRGGYEERSHGGGRGSGRRDDDRDHRLHGRGRRPRS 240
RR+LFGR RRR SRSRSRS H+ G+ +R H GGRG GRRDDDR+ R H +GRRPRS
Sbjct: 181 RRQLFGRYRRRHSRSRSRSPQAHR---GHGDRPH-GGRGYGRRDDDRNQRYHDKGRRPRS 236
Query: 241 RSPGRRGGRSRSPGARR-RSPVRESSVERRAKIEQWNREKEQADSGNKVDNSSYNDDRND 299
RSPG R GRSRSP RR RSPVRE+S ERRAKI QWNREKEQAD+GN N D+
Sbjct: 237 RSPGHR-GRSRSPPGRRDRSPVRENSEERRAKIAQWNREKEQADTGNNDVNHDVTDNH-- 293
Query: 300 DDRDGNGFTPNGGEYSD-PQQ 319
NGF NG +Y D PQQ
Sbjct: 294 ----ANGFQDNGEDYYDHPQQ 310
|
Source: Mus musculus Species: Mus musculus Genus: Mus Family: Muridae Order: Rodentia Class: Mammalia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|356505320|ref|XP_003521439.1| PREDICTED: splicing factor U2af small subunit B-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255575357|ref|XP_002528581.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis] gi|223531977|gb|EEF33789.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356572520|ref|XP_003554416.1| PREDICTED: splicing factor U2af small subunit B-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|294463000|gb|ADE77038.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|449451104|ref|XP_004143302.1| PREDICTED: splicing factor U2af small subunit A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449528561|ref|XP_004171272.1| PREDICTED: splicing factor U2af small subunit A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449443402|ref|XP_004139466.1| PREDICTED: splicing factor U2af small subunit A-like [Cucumis sativus] gi|449510609|ref|XP_004163713.1| PREDICTED: splicing factor U2af small subunit A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255573032|ref|XP_002527446.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis] gi|223533181|gb|EEF34938.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388521171|gb|AFK48647.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 320 | ||||||
| TAIR|locus:2165447 | 283 | U2AF35B [Arabidopsis thaliana | 0.55 | 0.621 | 0.806 | 2.8e-82 | |
| TAIR|locus:2196929 | 296 | ATU2AF35A [Arabidopsis thalian | 0.55 | 0.594 | 0.806 | 3.6e-82 | |
| GENEDB_PFALCIPARUM|PF11_0200 | 294 | PF11_0200 "U2 snRNP auxiliary | 0.543 | 0.591 | 0.525 | 1.8e-54 | |
| UNIPROTKB|Q8IIH4 | 294 | PF11_0200 "U2 snRNP auxiliary | 0.543 | 0.591 | 0.525 | 1.8e-54 | |
| UNIPROTKB|F1PUP0 | 240 | U2AF1 "Uncharacterized protein | 0.55 | 0.733 | 0.576 | 1.1e-53 | |
| ZFIN|ZDB-GENE-020419-1 | 250 | u2af1 "U2(RNU2) small nuclear | 0.55 | 0.704 | 0.573 | 2.4e-53 | |
| UNIPROTKB|Q98SE2 | 237 | U2AF1 "U2snRNP auxiliary facto | 0.55 | 0.742 | 0.576 | 3e-53 | |
| UNIPROTKB|A1A4K8 | 237 | U2AF1 "Splicing factor U2AF 35 | 0.55 | 0.742 | 0.576 | 3e-53 | |
| UNIPROTKB|J9P492 | 240 | U2AF1 "Uncharacterized protein | 0.55 | 0.733 | 0.576 | 3e-53 | |
| UNIPROTKB|Q01081 | 240 | U2AF1 "Splicing factor U2AF 35 | 0.55 | 0.733 | 0.576 | 3e-53 |
| TAIR|locus:2165447 U2AF35B [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 791 (283.5 bits), Expect = 2.8e-82, Sum P(2) = 2.8e-82
Identities = 142/176 (80%), Positives = 155/176 (88%)
Query: 1 MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITP 60
MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLH +P+ISPTLLLSNMYQRPDMITP
Sbjct: 1 MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLLLSNMYQRPDMITP 60
Query: 61 GVDPQGQALDPRKIQDHXXXXXXXXXXXXSKYGEIESLNICDNLADHMVGNVYVQFREEE 120
GVDPQGQ LDP KIQDH +K+GE+ESLN+CDNLADHM+GNVYV F+EE+
Sbjct: 61 GVDPQGQPLDPSKIQDHFEDFYEDIFEELNKFGEVESLNVCDNLADHMIGNVYVLFKEED 120
Query: 121 HAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENVCNRGGYCNFMHLKKI 176
HAA AL+ L GRFY+GRPII DFSPVTDFREATCRQYEEN CNRGGYCNFMH+K+I
Sbjct: 121 HAAAALQALQGRFYSGRPIIADFSPVTDFREATCRQYEENSCNRGGYCNFMHVKQI 176
|
|
| TAIR|locus:2196929 ATU2AF35A [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF11_0200 PF11_0200 "U2 snRNP auxiliary factor, small subunit, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IIH4 PF11_0200 "U2 snRNP auxiliary factor, small subunit, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PUP0 U2AF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020419-1 u2af1 "U2(RNU2) small nuclear RNA auxiliary factor 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q98SE2 U2AF1 "U2snRNP auxiliary factor small subunit" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1A4K8 U2AF1 "Splicing factor U2AF 35 kDa subunit" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P492 U2AF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q01081 U2AF1 "Splicing factor U2AF 35 kDa subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00021681001 | SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (317 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00010279001 | • | • | • | • | 0.469 | ||||||
| GSVIVG00024970001 | • | • | • | 0.459 | |||||||
| GSVIVG00000599001 | • | • | • | • | 0.404 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 320 | |||
| cd12539 | 103 | cd12539, RRM_U2AF35B, RNA recognition motif in spl | 7e-68 | |
| cd12287 | 102 | cd12287, RRM_U2AF35_like, RNA recognition motif in | 5e-49 | |
| cd12538 | 104 | cd12538, RRM_U2AF35, RNA recognition motif in U2 s | 3e-39 | |
| cd12540 | 105 | cd12540, RRM_U2AFBPL, RNA recognition motif in U2 | 9e-23 | |
| cd12285 | 85 | cd12285, RRM3_RBM39_like, RNA recognition motif 3 | 1e-16 | |
| cd00590 | 72 | cd00590, RRM_SF, RNA recognition motif (RRM) super | 9e-13 | |
| cd12232 | 89 | cd12232, RRM3_U2AF65, RNA recognition motif 3 foun | 1e-12 | |
| smart00360 | 73 | smart00360, RRM, RNA recognition motif | 6e-10 | |
| smart00361 | 70 | smart00361, RRM_1, RNA recognition motif | 6e-10 | |
| pfam13893 | 56 | pfam13893, RRM_5, RNA recognition motif | 1e-09 | |
| cd12374 | 85 | cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti | 7e-09 | |
| cd12282 | 91 | cd12282, RRM2_TatSF1_like, RNA recognition motif 2 | 2e-08 | |
| cd12414 | 76 | cd12414, RRM2_RBM28_like, RNA recognition motif 2 | 3e-08 | |
| pfam00076 | 70 | pfam00076, RRM_1, RNA recognition motif | 4e-08 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 3e-07 | |
| pfam14259 | 69 | pfam14259, RRM_6, RNA recognition motif (a | 3e-06 | |
| cd12246 | 78 | cd12246, RRM1_U1A_like, RNA recognition motif 1 in | 3e-06 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 4e-06 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 4e-06 | |
| cd12647 | 96 | cd12647, RRM_UHM_SPF45, RNA recognition motif in U | 4e-06 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 7e-06 | |
| cd12648 | 98 | cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i | 1e-05 | |
| cd12316 | 74 | cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot | 1e-05 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 2e-05 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 4e-05 | |
| cd12298 | 78 | cd12298, RRM3_Prp24, RNA recognition motif 3 in fu | 5e-05 | |
| cd12415 | 82 | cd12415, RRM3_RBM28_like, RNA recognition motif 3 | 5e-05 | |
| cd12398 | 75 | cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot | 5e-05 | |
| cd12341 | 68 | cd12341, RRM_hnRNPC_like, RNA recognition motif in | 6e-05 | |
| cd12465 | 88 | cd12465, RRM_UHMK1, RNA recognition motif found in | 7e-05 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 9e-05 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 9e-05 | |
| cd12418 | 75 | cd12418, RRM_Aly_REF_like, RNA recognition motif i | 1e-04 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 2e-04 | |
| cd12355 | 80 | cd12355, RRM_RBM18, RNA recognition motif in eukar | 2e-04 | |
| pfam00642 | 27 | pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t | 2e-04 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 3e-04 | |
| cd12423 | 74 | cd12423, RRM3_PTBP1_like, RNA recognition motif 3 | 3e-04 | |
| cd12284 | 73 | cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 | 3e-04 | |
| cd12352 | 72 | cd12352, RRM1_TIA1_like, RNA recognition motif 1 i | 4e-04 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 6e-04 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 7e-04 | |
| cd12306 | 73 | cd12306, RRM_II_PABPs, RNA recognition motif in ty | 7e-04 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 0.001 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 0.001 | |
| cd12324 | 88 | cd12324, RRM_RBM8, RNA recognition motif in RNA-bi | 0.001 | |
| cd12378 | 80 | cd12378, RRM1_I_PABPs, RNA recognition motif 1 in | 0.001 | |
| cd12399 | 78 | cd12399, RRM_HP0827_like, RNA recognition motif in | 0.001 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 0.002 | |
| cd12675 | 83 | cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye | 0.002 | |
| cd12477 | 89 | cd12477, RRM1_U1A, RNA recognition motif 1 found i | 0.002 | |
| cd12342 | 71 | cd12342, RRM_Nab3p, RNA recognition motif in yeast | 0.002 | |
| cd12570 | 76 | cd12570, RRM5_MRD1, RNA recognition motif 5 in yea | 0.002 | |
| cd12454 | 80 | cd12454, RRM2_RIM4_like, RNA recognition motif 2 i | 0.004 | |
| cd12364 | 81 | cd12364, RRM_RDM1, RNA recognition motif of RAD52 | 0.004 | |
| cd12380 | 80 | cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou | 0.004 |
| >gnl|CDD|240983 cd12539, RRM_U2AF35B, RNA recognition motif in splicing factor U2AF 35 kDa subunit B (U2AF35B) | Back alignment and domain information |
|---|
Score = 206 bits (527), Expect = 7e-68
Identities = 75/103 (72%), Positives = 89/103 (86%), Gaps = 1/103 (0%)
Query: 44 PTLLLSNMYQRPDMITPGVDP-QGQALDPRKIQDHFEDFYEDLFEELSKYGEIESLNICD 102
PT+LLSNMYQ P PG QGQ+LDPR++Q+HFEDFYED+FEELSK+GE+E+LN+CD
Sbjct: 1 PTILLSNMYQSPIAGAPGGPRGQGQSLDPRELQEHFEDFYEDIFEELSKFGEVEALNVCD 60
Query: 103 NLADHMVGNVYVQFREEEHAANALRNLNGRFYAGRPIIVDFSP 145
NL DHMVGNVYV+FR+EEHAA AL+ L GRFY GRPIIV+FSP
Sbjct: 61 NLGDHMVGNVYVKFRDEEHAAAALKALQGRFYDGRPIIVEFSP 103
|
This subgroup corresponds to the RRM of U2AF35B, also termed zinc finger CCCH domain-containing protein 60 (C3H60), which is one of the small subunits of U2 small nuclear ribonucleoprotein (snRNP) auxiliary factor (U2AF). It has been implicated in the recruitment of U2 snRNP to pre-mRNAs and is a highly conserved heterodimer composed of large and small subunits. Members in this family are mainly found in plant. They show high sequence homology to vertebrates U2AF35 that directly binds to the 3' splice site of the conserved AG dinucleotide and performs multiple functions in the splicing process in a substrate-specific manner. U2AF35B contains two N-terminal zinc fingers, a central RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and a C-terminal arginine/serine (SR)-rich domain. In contrast to U2AF35, U2AF35B has a plant-specific conserved C-terminal region containing SERE motif(s), which may have an important function specific to higher plants. . Length = 103 |
| >gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240982 cd12538, RRM_U2AF35, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) | Back alignment and domain information |
|---|
| >gnl|CDD|240984 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214636 smart00360, RRM, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a | Back alignment and domain information |
|---|
| >gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240911 cd12465, RRM_UHMK1, RNA recognition motif found in U2AF homology motif kinase 1 (UHMK1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) | Back alignment and domain information |
|---|
| >gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 100.0 | |
| KOG0113 | 335 | consensus U1 small nuclear ribonucleoprotein (RRM | 99.74 | |
| KOG4207 | 256 | consensus Predicted splicing factor, SR protein su | 99.7 | |
| KOG0107 | 195 | consensus Alternative splicing factor SRp20/9G8 (R | 99.68 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 99.58 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.56 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.55 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.53 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.5 | |
| KOG0147 | 549 | consensus Transcriptional coactivator CAPER (RRM s | 99.47 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.45 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.43 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 99.43 | |
| KOG0153 | 377 | consensus Predicted RNA-binding protein (RRM super | 99.42 | |
| KOG0122 | 270 | consensus Translation initiation factor 3, subunit | 99.41 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.41 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.38 | |
| KOG0121 | 153 | consensus Nuclear cap-binding protein complex, sub | 99.35 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.35 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 99.35 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 99.31 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 99.31 | |
| KOG1548 | 382 | consensus Transcription elongation factor TAT-SF1 | 99.3 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 99.27 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 99.27 | |
| KOG0126 | 219 | consensus Predicted RNA-binding protein (RRM super | 99.26 | |
| KOG0125 | 376 | consensus Ataxin 2-binding protein (RRM superfamil | 99.26 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.26 | |
| KOG0114 | 124 | consensus Predicted RNA-binding protein (RRM super | 99.23 | |
| KOG0130 | 170 | consensus RNA-binding protein RBM8/Tsunagi (RRM su | 99.23 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.22 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.21 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 99.21 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.21 | |
| KOG0120 | 500 | consensus Splicing factor U2AF, large subunit (RRM | 99.17 | |
| smart00360 | 71 | RRM RNA recognition motif. | 99.16 | |
| KOG0105 | 241 | consensus Alternative splicing factor ASF/SF2 (RRM | 99.16 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 99.15 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.15 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.14 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 99.12 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.12 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 99.12 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.1 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 99.1 | |
| PLN03213 | 759 | repressor of silencing 3; Provisional | 99.1 | |
| KOG0131 | 203 | consensus Splicing factor 3b, subunit 4 [RNA proce | 99.1 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 99.1 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.09 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 99.06 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 99.05 | |
| KOG0108 | 435 | consensus mRNA cleavage and polyadenylation factor | 99.02 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 99.01 | |
| KOG0149 | 247 | consensus Predicted RNA-binding protein SEB4 (RRM | 98.98 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 98.95 | |
| KOG0110 | 725 | consensus RNA-binding protein (RRM superfamily) [G | 98.95 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 98.95 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 98.92 | |
| KOG0123 | 369 | consensus Polyadenylate-binding protein (RRM super | 98.9 | |
| KOG1996 | 378 | consensus mRNA splicing factor [RNA processing and | 98.87 | |
| KOG0124 | 544 | consensus Polypyrimidine tract-binding protein PUF | 98.83 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 98.83 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 98.82 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 98.82 | |
| KOG0110 | 725 | consensus RNA-binding protein (RRM superfamily) [G | 98.82 | |
| KOG0147 | 549 | consensus Transcriptional coactivator CAPER (RRM s | 98.76 | |
| KOG0124 | 544 | consensus Polypyrimidine tract-binding protein PUF | 98.76 | |
| KOG4212 | 608 | consensus RNA-binding protein hnRNP-M [RNA process | 98.67 | |
| KOG0131 | 203 | consensus Splicing factor 3b, subunit 4 [RNA proce | 98.67 | |
| KOG4208 | 214 | consensus Nucleolar RNA-binding protein NIFK [Gene | 98.66 | |
| KOG0123 | 369 | consensus Polyadenylate-binding protein (RRM super | 98.62 | |
| KOG0132 | 894 | consensus RNA polymerase II C-terminal domain-bind | 98.6 | |
| KOG4454 | 267 | consensus RNA binding protein (RRM superfamily) [G | 98.58 | |
| KOG0146 | 371 | consensus RNA-binding protein ETR-3 (RRM superfami | 98.58 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 98.58 | |
| KOG0533 | 243 | consensus RRM motif-containing protein [RNA proces | 98.38 | |
| KOG0146 | 371 | consensus RNA-binding protein ETR-3 (RRM superfami | 98.38 | |
| KOG4212 | 608 | consensus RNA-binding protein hnRNP-M [RNA process | 98.37 | |
| KOG4209 | 231 | consensus Splicing factor RNPS1, SR protein superf | 98.28 | |
| KOG4660 | 549 | consensus Protein Mei2, essential for commitment t | 98.25 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 98.13 | |
| KOG0106 | 216 | consensus Alternative splicing factor SRp55/B52/SR | 98.12 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 98.11 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 98.07 | |
| KOG1548 | 382 | consensus Transcription elongation factor TAT-SF1 | 97.98 | |
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 97.96 | |
| KOG1190 | 492 | consensus Polypyrimidine tract-binding protein [RN | 97.96 | |
| KOG4676 | 479 | consensus Splicing factor, arginine/serine-rich [R | 97.95 | |
| KOG0116 | 419 | consensus RasGAP SH3 binding protein rasputin, con | 97.88 | |
| PF11608 | 90 | Limkain-b1: Limkain b1; InterPro: IPR024582 This e | 97.83 | |
| KOG4205 | 311 | consensus RNA-binding protein musashi/mRNA cleavag | 97.76 | |
| KOG0226 | 290 | consensus RNA-binding proteins [General function p | 97.61 | |
| KOG1995 | 351 | consensus Conserved Zn-finger protein [General fun | 97.6 | |
| KOG0151 | 877 | consensus Predicted splicing regulator, contains R | 97.6 | |
| KOG1457 | 284 | consensus RNA binding protein (contains RRM repeat | 97.59 | |
| KOG4205 | 311 | consensus RNA-binding protein musashi/mRNA cleavag | 97.52 | |
| PF08952 | 146 | DUF1866: Domain of unknown function (DUF1866) ; In | 97.44 | |
| PF14605 | 53 | Nup35_RRM_2: Nup53/35/40-type RNA recognition moti | 97.36 | |
| PF08777 | 105 | RRM_3: RNA binding motif; InterPro: IPR014886 This | 97.29 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 97.29 | |
| KOG0106 | 216 | consensus Alternative splicing factor SRp55/B52/SR | 97.28 | |
| KOG1855 | 484 | consensus Predicted RNA-binding protein [General f | 97.2 | |
| KOG1190 | 492 | consensus Polypyrimidine tract-binding protein [RN | 97.17 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 97.1 | |
| KOG1456 | 494 | consensus Heterogeneous nuclear ribonucleoprotein | 97.09 | |
| PF05172 | 100 | Nup35_RRM: Nup53/35/40-type RNA recognition motif; | 97.01 | |
| KOG0120 | 500 | consensus Splicing factor U2AF, large subunit (RRM | 96.96 | |
| KOG4676 | 479 | consensus Splicing factor, arginine/serine-rich [R | 96.78 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 96.77 | |
| KOG1456 | 494 | consensus Heterogeneous nuclear ribonucleoprotein | 96.64 | |
| KOG1365 | 508 | consensus RNA-binding protein Fusilli, contains RR | 96.55 | |
| KOG2416 | 718 | consensus Acinus (induces apoptotic chromatin cond | 96.47 | |
| KOG4210 | 285 | consensus Nuclear localization sequence binding pr | 96.43 | |
| KOG4307 | 944 | consensus RNA binding protein RBM12/SWAN [General | 96.41 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 96.27 | |
| KOG1457 | 284 | consensus RNA binding protein (contains RRM repeat | 96.19 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 96.15 | |
| PF04847 | 184 | Calcipressin: Calcipressin; InterPro: IPR006931 Ca | 96.14 | |
| PF15023 | 166 | DUF4523: Protein of unknown function (DUF4523) | 96.12 | |
| KOG2068 | 327 | consensus MOT2 transcription factor [Transcription | 95.88 | |
| KOG4368 | 757 | consensus Predicted RNA binding protein, contains | 95.81 | |
| KOG3152 | 278 | consensus TBP-binding protein, activator of basal | 94.99 | |
| KOG4285 | 350 | consensus Mitotic phosphoprotein [Cell cycle contr | 94.98 | |
| KOG2135 | 526 | consensus Proteins containing the RNA recognition | 94.66 | |
| KOG4574 | 1007 | consensus RNA-binding protein (contains RRM and Pu | 94.33 | |
| KOG0112 | 975 | consensus Large RNA-binding protein (RRM superfami | 94.14 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 94.02 | |
| KOG0105 | 241 | consensus Alternative splicing factor ASF/SF2 (RRM | 93.29 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 92.93 | |
| KOG0115 | 275 | consensus RNA-binding protein p54nrb (RRM superfam | 92.26 | |
| PF15519 | 73 | RBM39linker: linker between RRM2 and RRM3 domains | 91.33 | |
| KOG2591 | 684 | consensus c-Mpl binding protein, contains La domai | 91.23 | |
| PF08675 | 87 | RNA_bind: RNA binding domain; InterPro: IPR014789 | 91.16 | |
| KOG0129 | 520 | consensus Predicted RNA-binding protein (RRM super | 90.9 | |
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 90.74 | |
| KOG0129 | 520 | consensus Predicted RNA-binding protein (RRM super | 90.57 | |
| KOG1365 | 508 | consensus RNA-binding protein Fusilli, contains RR | 90.48 | |
| KOG0112 | 975 | consensus Large RNA-binding protein (RRM superfami | 89.8 | |
| KOG4307 | 944 | consensus RNA binding protein RBM12/SWAN [General | 89.12 | |
| PF11767 | 66 | SET_assoc: Histone lysine methyltransferase SET as | 88.33 | |
| KOG0835 | 367 | consensus Cyclin L [General function prediction on | 87.64 | |
| PF03880 | 74 | DbpA: DbpA RNA binding domain ; InterPro: IPR00558 | 87.16 | |
| KOG0151 | 877 | consensus Predicted splicing regulator, contains R | 85.97 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 85.55 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 80.96 |
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.9e-51 Score=363.45 Aligned_cols=191 Identities=66% Similarity=1.157 Sum_probs=183.4
Q ss_pred CHHHHHHhhCCCCCCccccCceeccCCCCCCccccCCCCCCCCCeEEecCCCCCCCCCCCCCCCCCCCCChhhHhhhHHH
Q 045807 1 MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPSISPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFED 80 (320)
Q Consensus 1 ~~~~~~~~~~~~~~~~~c~f~~k~g~cr~g~~cs~~h~~p~~S~tl~i~Nl~~~~~~~~~~~~~~~~~~d~~~i~~~~~~ 80 (320)
|||+||+|||||+|++||+|||||||||||++|+++|++|+.|+||+|+|||++|.+..+..++..+.+++++||.+|++
T Consensus 1 mae~lasifgtekdKv~c~fy~k~gacR~gdrcsR~h~kpt~s~t~ll~nmyq~P~~~~~~~d~~~~~~~de~~q~~~de 80 (260)
T KOG2202|consen 1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHEKPTFSQTVLLKNMYQNPENSWERRDAQGQFLTDEELQRHEDE 80 (260)
T ss_pred CchHHHHHhcccccccccchHHhhcccccccHHHHhhcccccchHHHHHHHHhCCCCCchhhhhccccccHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999877766667889999999999999
Q ss_pred HHHHHHHHHh-cCCCeeEEEEecCCCCCceeEEEEEECCHHHHHHHHHHhCCceeCCeeEEEEeecCCCcchhhhhcccc
Q 045807 81 FYEDLFEELS-KYGEIESLNICDNLADHMVGNVYVQFREEEHAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEE 159 (320)
Q Consensus 81 ~eedL~~~F~-k~G~I~~v~i~~~~tg~~~G~afV~F~~~e~A~~A~~~lnG~~~~Gr~I~V~~~~~~~~~~~~~~~~~~ 159 (320)
+++||+.+|+ |||+|+.+.|+.+...+..|.|||.|..+++|++|++.|||.||.|++|.+++++++.|++++|++++.
T Consensus 81 fyEd~f~E~~~kygEiee~~Vc~Nl~~hl~GNVYV~f~~Ee~ae~a~~~lnnRw~~G~pi~ae~~pvT~~rea~C~~~e~ 160 (260)
T KOG2202|consen 81 FYEDVFTELEDKYGEIEELNVCDNLGDHLVGNVYVKFRSEEDAEAALEDLNNRWYNGRPIHAELSPVTDFREAICGQFER 160 (260)
T ss_pred HHHHHHHHHHHHhhhhhhhhhhcccchhhhhhhhhhcccHHHHHHHHHHHcCccccCCcceeeecCcCchhhhhhccccc
Confidence 9999999999 999999999999888899999999999999999999999999999999999999999999999999999
Q ss_pred cccCCCCccccccccccCHHHHHhhhCCCccC
Q 045807 160 NVCNRGGYCNFMHLKKISRELRRRLFGRSRRR 191 (320)
Q Consensus 160 ~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~ 191 (320)
+.|++|+.|||||++..+..+.+.++......
T Consensus 161 ~~C~rG~~CnFmH~k~~sr~L~r~l~~~~~~~ 192 (260)
T KOG2202|consen 161 TECSRGGACNFMHVKRLSRSLRRELYGRQRKR 192 (260)
T ss_pred ccCCCCCcCcchhhhhhhHHHHHHhhhhhhcc
Confidence 99999999999999999999999988876553
|
|
| >KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03213 repressor of silencing 3; Provisional | Back alignment and domain information |
|---|
| >KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1996 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] | Back alignment and domain information |
|---|
| >KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] | Back alignment and domain information |
|---|
| >KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0533 consensus RRM motif-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes | Back alignment and domain information |
|---|
| >KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0226 consensus RNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1995 consensus Conserved Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function | Back alignment and domain information |
|---|
| >PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif | Back alignment and domain information |
|---|
| >PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1855 consensus Predicted RNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] | Back alignment and domain information |
|---|
| >KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4210 consensus Nuclear localization sequence binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells | Back alignment and domain information |
|---|
| >PF15023 DUF4523: Protein of unknown function (DUF4523) | Back alignment and domain information |
|---|
| >KOG2068 consensus MOT2 transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4368 consensus Predicted RNA binding protein, contains SWAP, RPR and G-patch domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] | Back alignment and domain information |
|---|
| >KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF15519 RBM39linker: linker between RRM2 and RRM3 domains in RBM39 protein; PDB: 3S6E_A 2LQ5_A | Back alignment and domain information |
|---|
| >KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) | Back alignment and domain information |
|---|
| >KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] | Back alignment and domain information |
|---|
| >PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes | Back alignment and domain information |
|---|
| >KOG0835 consensus Cyclin L [General function prediction only] | Back alignment and domain information |
|---|
| >PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] | Back alignment and domain information |
|---|
| >KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 320 | ||||
| 1jmt_A | 104 | X-Ray Structure Of A Core U2af65U2AF35 HETERODIMER | 6e-17 |
| >pdb|1JMT|A Chain A, X-Ray Structure Of A Core U2af65U2AF35 HETERODIMER Length = 104 | Back alignment and structure |
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 99.89 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 99.84 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 99.84 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 99.84 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 99.83 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 99.82 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 99.81 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 99.8 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 99.72 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 99.71 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 99.68 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 99.67 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 99.67 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 99.66 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 99.66 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 99.66 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 99.66 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 99.66 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 99.65 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 99.65 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.65 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 99.65 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 99.65 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.65 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 99.64 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 99.64 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 99.64 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 99.64 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 99.64 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 99.64 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 99.64 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 99.64 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 99.64 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 99.64 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 99.63 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 99.63 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 99.63 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 99.63 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 99.63 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.63 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 99.63 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 99.63 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 99.63 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 99.62 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 99.62 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 99.62 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 99.62 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 99.62 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 99.62 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 99.62 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 99.62 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 99.62 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 99.62 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 99.62 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.61 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 99.61 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 99.61 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 99.61 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 99.61 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 99.61 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 99.6 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.6 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 99.6 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 99.6 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 99.6 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 99.6 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 99.6 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 99.6 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 99.6 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 99.6 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 99.6 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.6 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 99.59 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 99.59 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 99.59 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 99.59 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 99.59 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 99.59 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 99.59 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 99.58 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 99.58 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 99.58 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 99.58 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 99.58 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 99.58 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 99.58 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 99.58 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 99.57 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 99.57 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 99.57 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 99.57 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.57 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 99.57 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 99.57 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 99.57 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 99.57 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 99.56 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 99.56 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 99.56 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 99.55 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 99.55 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 99.55 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 99.55 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 99.55 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 99.55 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 99.55 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.55 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 99.54 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.54 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 99.54 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 99.54 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 99.54 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 99.54 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 99.54 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 99.54 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 99.54 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 99.54 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 99.54 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 99.54 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 99.53 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.53 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 99.53 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 99.53 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 99.53 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.53 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 99.53 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 99.53 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 99.53 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 99.53 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 99.53 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 99.53 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 99.52 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 99.52 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 99.52 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 99.52 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 99.52 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 99.51 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 99.51 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.51 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 99.5 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 99.5 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 99.5 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 99.5 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 99.5 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 99.5 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 99.5 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 99.49 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.49 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 99.49 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 99.49 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 99.49 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 99.49 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 99.49 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 99.48 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.48 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 99.48 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.48 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.47 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 99.47 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 99.47 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 99.47 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 99.2 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.46 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 99.46 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.46 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 99.46 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 99.45 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.45 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 99.44 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.44 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 99.43 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 99.43 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.43 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.42 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.42 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.41 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.41 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.4 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.4 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 99.39 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.39 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.38 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 99.38 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.36 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 99.36 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 99.35 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 99.35 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 99.35 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.33 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.31 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.31 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.31 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.29 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 99.29 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.28 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.28 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.27 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.26 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.24 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.23 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.2 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.2 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 99.16 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.11 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.1 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 99.1 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 98.98 | |
| 1owx_A | 121 | Lupus LA protein, SS-B, LA; RRM, transcription; NM | 98.67 | |
| 2l9w_A | 117 | U4/U6 snRNA-associated-splicing factor PRP24; RRM, | 97.92 | |
| 1wey_A | 104 | Calcipressin 1; structural genomics, RRM domain, r | 97.78 | |
| 1wwh_A | 119 | Nucleoporin 35, nucleoporin; structural genomics, | 97.07 | |
| 3p3d_A | 132 | Nucleoporin 53; structural genomics, PSI-2, protei | 96.4 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 95.8 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 95.59 | |
| 1whv_A | 100 | Poly(A)-specific ribonuclease; RNA recognition mot | 95.09 | |
| 1uw4_A | 91 | UPF3X; nonsense mediated mRNA decay protein, RNA-b | 94.51 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 93.85 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 93.43 | |
| 3ctr_A | 101 | Poly(A)-specific ribonuclease PARN; protein-RNA-co | 91.78 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 91.09 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 90.57 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 90.03 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 89.3 | |
| 3pq1_A | 464 | Poly(A) RNA polymerase; nucleotidyl transferase, R | 89.12 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 88.5 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 88.25 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 87.3 | |
| 2l08_A | 97 | Regulator of nonsense transcripts 3A; NESG, nonsen | 85.11 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 83.81 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 82.06 |
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
Probab=99.89 E-value=1.1e-23 Score=167.57 Aligned_cols=103 Identities=45% Similarity=0.900 Sum_probs=87.3
Q ss_pred CCeEEecCCCCCCCCCCCCCCCCCCCCChhhHhhhHHHHHHHHHHHH-hcCCCeeEEEEecCCCCCceeEEEEEECCHHH
Q 045807 43 SPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDFYEDLFEEL-SKYGEIESLNICDNLADHMVGNVYVQFREEEH 121 (320)
Q Consensus 43 S~tl~i~Nl~~~~~~~~~~~~~~~~~~d~~~i~~~~~~~eedL~~~F-~k~G~I~~v~i~~~~tg~~~G~afV~F~~~e~ 121 (320)
|+||+|+|||++|.+.....+.....+++++|+++|++++++|+++| ++||+|+.|.|+.+.+++++|||||+|.++++
T Consensus 1 s~~~~l~nm~~~p~~~~~~~~~l~~~~~~~~l~~~f~~~~edl~~~f~~~~G~V~~v~i~~~~~~~~~G~~fV~f~~~~~ 80 (104)
T 1jmt_A 1 SQTIALLNIYRNPQNSSQSADGLRSAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREED 80 (104)
T ss_dssp CCEEEEEEEEECCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCEEEEEECCSSSSSSEEEEEEEESCHHH
T ss_pred CcEEEEeeccCCccccccccCCcccccCHHHHHHHHHHHHHHHHHHhhccCCceEEEEEEeCCCCCccEEEEEEECCHHH
Confidence 68999999998776643321111234678899999999999999999 99999999999987678899999999999999
Q ss_pred HHHHHHHhCCceeCCeeEEEEeec
Q 045807 122 AANALRNLNGRFYAGRPIIVDFSP 145 (320)
Q Consensus 122 A~~A~~~lnG~~~~Gr~I~V~~~~ 145 (320)
|++|++.|||++|+|++|.|+|++
T Consensus 81 A~~A~~~lng~~~~Gr~i~v~~sp 104 (104)
T 1jmt_A 81 AEKAVIDLNNRWFNGQPIHAELSP 104 (104)
T ss_dssp HHHHHHHHTTCEETTEECCEEECC
T ss_pred HHHHHHHHCCCEECCEEEEEEEcC
Confidence 999999999999999999999974
|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* | Back alignment and structure |
|---|
| >1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 320 | ||||
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | d.58.7.3 (A:) 1e-29 | ||
| d1o0pa_ | 104 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 5e-18 | |
| d2dita1 | 99 | d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma | 1e-14 | |
| d1no8a_ | 78 | d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu | 1e-10 | |
| d1cvja1 | 80 | d.58.7.1 (A:11-90) Poly(A)-binding protein {Human | 6e-10 | |
| d2f9da1 | 114 | d.58.7.1 (A:12-125) Pre-mRNA branch site protein p | 4e-08 | |
| d1h2vz_ | 93 | d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro | 1e-07 | |
| d2cqba1 | 89 | d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer | 2e-07 | |
| d1b7fa1 | 82 | d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil | 2e-07 | |
| d1wf2a_ | 98 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 4e-07 | |
| d1b7fa2 | 85 | d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil | 4e-07 | |
| d2cpfa1 | 85 | d.58.7.1 (A:362-446) Probable RNA-binding protein | 8e-07 | |
| d1fxla2 | 85 | d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho | 1e-06 | |
| d2cqia1 | 90 | d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa | 2e-06 | |
| d2cpha1 | 94 | d.58.7.1 (A:454-547) Probable RNA-binding protein | 5e-06 | |
| d1fxla1 | 82 | d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom | 1e-05 | |
| d2cqca1 | 83 | d.58.7.1 (A:109-191) Arginine/serine-rich splicing | 1e-05 | |
| d2cpja1 | 86 | d.58.7.1 (A:65-150) Non-POU domain-containing octa | 1e-05 | |
| d1x5ua1 | 93 | d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu | 2e-05 | |
| d1rk8a_ | 88 | d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr | 3e-05 | |
| d1nu4a_ | 91 | d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo | 4e-05 | |
| d2u2fa_ | 85 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 4e-05 | |
| d1x4ga1 | 96 | d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s | 5e-05 | |
| d1x4aa1 | 95 | d.58.7.1 (A:9-103) Splicing factor, arginine/serin | 9e-05 | |
| d1fjca_ | 96 | d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice | 1e-04 | |
| d2ghpa1 | 81 | d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici | 2e-04 | |
| d2cq3a1 | 93 | d.58.7.1 (A:110-202) RNA-binding protein 9 {Human | 2e-04 | |
| d1x5ta1 | 83 | d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu | 2e-04 | |
| d1cvja2 | 89 | d.58.7.1 (A:91-179) Poly(A)-binding protein {Human | 2e-04 | |
| d1uawa_ | 77 | d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax | 2e-04 | |
| d2cq0a1 | 90 | d.58.7.1 (A:231-320) Eukaryotic translation initia | 2e-04 | |
| d2disa1 | 96 | d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { | 2e-04 | |
| d2cpea1 | 101 | d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma | 2e-04 | |
| d1wg1a_ | 88 | d.58.7.1 (A:) Probable RNA-binding protein KIAA157 | 8e-04 | |
| d1p1ta_ | 104 | d.58.7.1 (A:) Cleavage stimulation factor, 64 kda | 8e-04 | |
| d1x5oa1 | 101 | d.58.7.1 (A:8-108) RNA-binding motif, single-stran | 0.001 | |
| d2bz2a1 | 79 | d.58.7.1 (A:35-113) Negative elongation factor E, | 0.001 | |
| d1whwa_ | 99 | d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm | 0.001 | |
| d1weya_ | 104 | d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) | 0.003 | |
| d1x5sa1 | 90 | d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote | 0.003 | |
| d1ufwa_ | 95 | d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) | 0.004 |
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Splicing factor U2AF subunits domain: U2AF35 (35 KDa subunit) species: Human (Homo sapiens) [TaxId: 9606]
Score = 106 bits (266), Expect = 1e-29
Identities = 46/104 (44%), Positives = 72/104 (69%), Gaps = 1/104 (0%)
Query: 43 SPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDFYEDLFEEL-SKYGEIESLNIC 101
S T+ L N+Y+ P + D A+ ++Q+H+++F+E++F E+ KYGE+E +N+C
Sbjct: 1 SQTIALLNIYRNPQNSSQSADGLRSAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVC 60
Query: 102 DNLADHMVGNVYVQFREEEHAANALRNLNGRFYAGRPIIVDFSP 145
DNL DH+VGNVYV+FR EE A A+ +LN R++ G+PI + SP
Sbjct: 61 DNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSP 104
|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 99.86 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 99.79 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.78 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.72 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.71 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 99.71 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 99.71 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 99.71 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 99.7 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 99.7 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 99.7 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.68 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.68 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.68 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.68 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 99.67 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 99.67 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 99.67 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.65 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 99.65 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.65 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.65 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.65 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.65 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 99.65 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 99.64 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.64 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 99.64 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.63 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.62 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.62 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.61 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.61 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 99.61 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 99.61 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 99.61 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 99.6 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.6 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 99.6 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.6 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 99.6 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 99.59 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 99.59 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.59 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 99.59 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.58 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 99.58 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 99.58 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.58 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 99.58 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.58 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.57 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 99.57 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 99.57 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 99.57 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 99.56 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.56 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 99.56 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.55 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 99.55 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 99.54 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 99.54 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 99.54 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.53 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 99.53 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 99.53 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.52 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.52 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 99.52 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 99.52 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.51 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 99.51 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.51 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.51 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 99.51 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 99.5 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 99.49 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 99.48 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.47 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 99.44 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.41 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.32 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 99.3 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.21 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.15 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 99.1 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.02 | |
| d1ufwa_ | 95 | Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] | 98.15 | |
| d2dgxa1 | 73 | Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 | 97.8 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 95.34 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 95.34 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 95.17 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 95.12 | |
| d1uw4a_ | 91 | RNA processing protein UPF3x, RRM domain {Human (H | 94.36 | |
| d1whva_ | 100 | Poly(A)-specific ribonuclease PARN {Mouse (Mus mus | 83.01 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 82.72 |
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Splicing factor U2AF subunits domain: U2AF35 (35 KDa subunit) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86 E-value=1.9e-22 Score=158.74 Aligned_cols=103 Identities=44% Similarity=0.829 Sum_probs=83.8
Q ss_pred CCeEEecCCCCCCCCCCCCCCCCCCCCChhhHhhhHHHHH-HHHHHHHhcCCCeeEEEEecCCCCCceeEEEEEECCHHH
Q 045807 43 SPTLLLSNMYQRPDMITPGVDPQGQALDPRKIQDHFEDFY-EDLFEELSKYGEIESLNICDNLADHMVGNVYVQFREEEH 121 (320)
Q Consensus 43 S~tl~i~Nl~~~~~~~~~~~~~~~~~~d~~~i~~~~~~~e-edL~~~F~k~G~I~~v~i~~~~tg~~~G~afV~F~~~e~ 121 (320)
|+||+|+|||.+|..+....+.....++...|+.+|+.+. ++|.++|++||+|+.|.|+++.+++++|+|||+|.+.++
T Consensus 1 s~~~~~~n~y~nP~~~~~~~~~~~~~~~~~~v~~~~~~~~ed~l~e~f~k~G~I~~v~I~~~~~~~~~G~~fV~f~~~~~ 80 (104)
T d1jmta_ 1 SQTIALLNIYRNPQNSSQSADGLRSAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREED 80 (104)
T ss_dssp CCEEEEEEEEECCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCEEEEEECCSSSSSSEEEEEEEESCHHH
T ss_pred CCEEEEEcccCCccccccccCCcccccchHHhhhhhhhhhHHHHHHHhccCCCEEEEEeecCCCCCEeeEEEEEEechhH
Confidence 6899999999999765433322223334566777887665 568889999999999999988899999999999999999
Q ss_pred HHHHHHHhCCceeCCeeEEEEeec
Q 045807 122 AANALRNLNGRFYAGRPIIVDFSP 145 (320)
Q Consensus 122 A~~A~~~lnG~~~~Gr~I~V~~~~ 145 (320)
|.+|++.|||++|+|++|.|+|++
T Consensus 81 A~~Ai~~lng~~~~gr~i~v~~sP 104 (104)
T d1jmta_ 81 AEKAVIDLNNRWFNGQPIHAELSP 104 (104)
T ss_dssp HHHHHHHHTTCEETTEECCEEECC
T ss_pred HHHHHHHHCCCEECCEEEEEEECC
Confidence 999999999999999999999974
|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|