Citrus Sinensis ID: 045809


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
MRNFASTFVHFSSAKISCFHQCFLGLFLSSIRFLVLKVNPLWIQLSYFISISSVGYLILRVSKPRDSSFINPKNIDVFFTSVSAMTGSSMSTVEMEVFSNFQLIIMTILMFVGGEVFISMFGLHARSKFYSLNQLFENRINPNLTPSSSSSSSSSSSENSTEFTDQIELGIVSHSYITNEEPNNGLENEHRMSSNDDNLKYNSVRVLVYVVLGYILVTHVVGSSLVALYTSLAPSAKQILKQKGLQIFTFSVFTTASTFSNCGFVPTNENMMVFKKNALLLLILFPQGLLGNTLYPSCLRFVIWVLKKITNREEFDYILRNSKEMIYRHLLSKAYSYFLAITVFGFIFVQLVLFCALEWDSEATDGLNFFEKLVASLFQVVNSRHTGESVFDISIISPAILVLFVVMMYLPPYTSFWPSRNREGDSRNFKEKKNKKKTFVQNFIFSQLSYLVIFIILVCITERDKMKKDPLNFNVLNVTIEVISAYGNVGFSTGYSCKRQLRPDSSCKDAWYGFVGRWSNQGKVILILVMFFGRIKKFNMKGGKAWQIS
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccccccccccEEEccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccEEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccEEEcccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccc
*****STFVHFSSAKISCFHQCFLGLFLSSIRFLVLKVNPLWIQLSYFISISSVGYLILRVSKPRDSSFINPKNIDVFFTSVSAMTGSSMSTVEMEVFSNFQLIIMTILMFVGGEVFISMFGLHARSKFYSLNQLFE**************************TDQIELGIVSHSYITNE******************LKYNSVRVLVYVVLGYILVTHVVGSSLVALYTSLAPSAKQILKQKGLQIFTFSVFTTASTFSNCGFVPTNENMMVFKKNALLLLILFPQGLLGNTLYPSCLRFVIWVLKKITNREEFDYILRNSKEMIYRHLLSKAYSYFLAITVFGFIFVQLVLFCALEWDSEATDGLNFFEKLVASLFQVVNSRHTGESVFDISIISPAILVLFVVMMYLPPYTSFWPSRNREGDSRNFKEKKNKKKTFVQNFIFSQLSYLVIFIILVCITERDKMKKDPLNFNVLNVTIEVISAYGNVGFSTGYSCKRQLRPDSSCKDAWYGFVGRWSNQGKVILILVMFFGRIKKFNMKGGKAWQIS
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNFASTFVHFSSAKISCFHQCFLGLFLSSIRFLVLKVNPLWIQLSYFISISSVGYLILRVSKPRDSSFINPKNIDVFFTSVSAMTGSSMSTVEMEVFSNFQLIIMTILMFVGGEVFISMFGLHARSKFYSLNQLFENRINPNLTPSSSSSSSSSSSENSTEFTDQIELGIVSHSYITNEEPNNGLENEHRMSSNDDNLKYNSVRVLVYVVLGYILVTHVVGSSLVALYTSLAPSAKQILKQKGLQIFTFSVFTTASTFSNCGFVPTNENMMVFKKNALLLLILFPQGLLGNTLYPSCLRFVIWVLKKITNREEFDYILRNSKEMIYRHLLSKAYSYFLAITVFGFIFVQLVLFCALEWDSEATDGLNFFEKLVASLFQVVNSRHTGESVFDISIISPAILVLFVVMMYLPPYTSFWPSRNREGDSRNFKEKKNKKKTFVQNFIFSQLSYLVIFIILVCITERDKMKKDPLNFNVLNVTIEVISAYGNVGFSTGYSCKRQLRPDSSCKDAWYGFVGRWSNQGKVILILVMFFGRIKKFNMKGGKAWQIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium transporter HKT1 Sodium transporter protein, which plays a central role in plant tolerance to salt. Upon prolongated exposure to high concentrations, Na(+) translocates from the roots to the transpiring leaves where it can increase to toxic level. Involved in Na(+) recirculation from shoots to roots, probably by mediating Na(+) loading into the phloem sap in shoots and unloading in roots, thereby removing large amounts of Na(+) from the shoot. Does not transport K(+) but regulates K(+) nutrient status via its ability to facilitate Na(+) homeostasis. Probably not involved in root uptake of Na(+).probableQ84TI7
Probable cation transporter HKT6 Probable cation transporter. May be involved in regulation of K(+)/Na(+) homeostasis.probableQ6H501

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PJZ, chain A
Confidence level:confident
Coverage over the Query: 42-132,201-235,246-314,327-462,473-547
View the alignment between query and template
View the model in PyMOL
Template: 3PJZ, chain A
Confidence level:confident
Coverage over the Query: 209-312,331-495,515-543
View the alignment between query and template
View the model in PyMOL