Citrus Sinensis ID: 045829

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-

MESGGGVPVHPAIAPISYLLGTWRGQGSGGYPTINAFDYGEELNFTHSGGKPVIAYTQKTWKLGSGEPMHAESGYWRPNPDGSIEVVIAQSTGLVEVQKGTYNAEEKVIKLQSELVGNASKVREVSRVFELVNGELRYVVQMATNHLTSLRPHLKAVLRKL

ccccccccccccccccccEEEEEEEEEECcccccccCEEEEEEEEECccccccEEEEEEEECcccccccCEEEEEEEEcccccEEEEEEEcccEEEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEEEccEEEEEEEEHHcccccccccEEEEEEEc

******V*VHPAIAPISYLLGTWRGQGSGGYPTINAFDYGEELNFTHSGGKPVIAYTQKTWKLGSGEPMHAESGYWRPNPDGSIEVVIAQSTGLVEVQKGTYNAEEKVIKLQSELVGNASKVREVSRVFELVNGELRYVVQMATNHLTSLRPHLKAVLRKL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MESGGGVPVHPAIAPISYLLGTWRGQGSGGYPTINAFDYGEELNFTHSGGKPVIAYTQKTWKLGSGEPMHAESGYWRPNPDGSIEVVIAQSTGLVEVQKGTYNAEEKVIKLQSELVGNASKVREVSRVFELVNGELRYVVQMATNHLTSLRPHLKAVLRKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UPF0678 fatty acid-binding protein-like protein At1g79260	May play a role in the intracellular transport of hydrophobic ligands.	confident	O64527
UPF0678 fatty acid-binding protein-like protein Mjls_0408	May play a role in the intracellular transport of hydrophobic ligands.	probable	A3PTJ4
UPF0678 fatty acid-binding protein-like protein Tfu_2872	May play a role in the intracellular transport of hydrophobic ligands.	probable	Q47KW7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A13, chain A
Confidence level:very confident
Coverage over the Query: 7-161
View the alignment between query and template
View the model in PyMOL