Citrus Sinensis ID: 045836

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MFSSIDSTVAAATQFLPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEAKLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGDPQKRLTIGKYGFLALLGLMVCTISFGINQLRG
ccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcc
********VAAATQFLPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEAKLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGDPQKRLTIGKYGFLALLGLMVCTISFGINQLRG
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSSIDSTVAAATQFLPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEAKLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGDPQKRLTIGKYGFLALLGLMVCTISFGINQLRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microsomal glutathione S-transferase 3 Also functions as a glutathione peroxidase.probableQ9CPU4
Microsomal glutathione S-transferase 3 Also functions as a glutathione peroxidase.probableQ3T100
Microsomal glutathione S-transferase 3 Also functions as a glutathione peroxidase.probableO14880

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PCV, chain A
Confidence level:very confident
Coverage over the Query: 17-131
View the alignment between query and template
View the model in PyMOL