Citrus Sinensis ID: 045858


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MGLALALPSRAQDLPQDYVNAHNAARAQVGVNPVKCDESIAAFARSYANRRYGENLAGSSGNLSGSDAVGLWVSEKADYDYNSNSCNAGKVCGHYTHVVWRNSVRIGCAKVRCNNGGTFVGCNYASPGDVVGQKPY
ccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEccccccccccccc
**LA********DLPQDYVNAHNAARAQVGVNPVKCDESIAAFARSYANRRYGENLAGSSGNLSGSDAVGLWVSEKADYDYNSNSCNAGKVCGHYTHVVWRNSVRIGCAKVRCNNGGTFVGCNYASPGDVVGQKPY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLALALPSRAQDLPQDYVNAHNAARAQVGVNPVKCDESIAAFARSYANRRYGENLAGSSGNLSGSDAVGLWVSEKADYDYNSNSCNAGKVCGHYTHVVWRNSVRIGCAKVRCNNGGTFVGCNYASPGDVVGQKPY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pathogenesis-related leaf protein 4 Probably involved in the defense reaction of plants against pathogens.probableQ04108
Pathogenesis-related protein 1B Probably involved in the defense reaction of plants against pathogens.probableP07053
Pathogenesis-related protein 1C Probably involved in the defense reaction of plants against pathogens.probableP09042

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CFE, chain A
Confidence level:very confident
Coverage over the Query: 12-136
View the alignment between query and template
View the model in PyMOL