Citrus Sinensis ID: 045871

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-

MNNNRQHQPHVSPSSTDYSSFDFNLRPSKRRGSYNCGRCGQPKKGHSCHVGTPSTPSPPAATPAPSDSSAAISAPTSLSASRPPRHQHYSRFRRALSFDNIDLTCESPEPDFAIEELLDPDPELSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRVPPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKNNPSALEDQYPFKRSADGSKRIRVPHSFSQ

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccccccHHHHHHHHHccccccEEccccccccccccEEccccccccccccHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccECcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccHHHHHHHHccccccEECccccccccHHHHHHccccccEEEECccccccHHHHHHHHHHccccccccccccccccccccccccccccc

***************************************************************************************************NIDLT*************L*****LSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRVPPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKNNPSALEDQYPFKRSADGSKRI*VP*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
F-box/LRR-repeat protein 17	Essential protein for male fertility. Component of the SCF(ASK-cullin-F-box) E3 ubiquitin ligase complex SCF(FBL17), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Enables the switch in cell cycle control leading to male germ cell lineage formation from microspores after meiosis. Targets CDKA-1 inhibitors the degradation specifically in male germ cells (e.g. KRP6 and KRP7) and thus enables CDKA-1 activation and germ cell S-phase progression. Promotes twin sperm cell production and double fertilization.	probable	Q8W104

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 129-510
View the alignment between query and template
View the model in PyMOL