Citrus Sinensis ID: 045871

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-

MNNNRQHQPHVSPSSTDYSSFDFNLRPSKRRGSYNCGRCGQPKKGHSCHVGTPSTPSPPAATPAPSDSSAAISAPTSLSASRPPRHQHYSRFRRALSFDNIDLTCESPEPDFAIEELLDPDPELSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRVPPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKNNPSALEDQYPFKRSADGSKRIRVPHSFSQ

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHcccccEEEccccccccccccHHHHHHHHHccccccEEccccccccccccEEccccccccccccHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccHHHHHHHHccccccEEEccccccccHHHHHHccccccEEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccc

ccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccHHHHEEcccccccccccccccccccccccccHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccEEEEcccccHHHcccHHHHHHHHHcccccEEEEcccccccccccEEEEHcccccccccHHHHHHHHHHcccHcHcHEccccccHHHHHHHHHHHHccHcccEEEccccccccHHHHHHHHHccccccEEEcccccccHHHHHHHHHHcccHHcEEEHcccccccHHHHHHHHHHcccccEcccccEEccccccccHHHccccHHHHHHHHHHccHHHHHHHHHcccccEEcccccHHHHHHHHcccHHHHccHHHcccccHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHcHHHcccccccccccccccEEEccccccc

mnnnrqhqphvspsstdyssfdfnlrpskrrgsyncgrcgqpkkghschvgtpstpsppaatpapsdssaaisaptslsasrpprhqhYSRFRRAlsfdnidltcespepdfaieelldpdpelsgglpaAALWEVLrrlpppglLAAAQVCKGWRETSRRLWRAAEELrlrvppraqvgfVGSVLQKCSALVRLSLTMESDVDATMLACIAfscpnlesmeiytsgsavnritgdeLGRFVADKRCLASLKmegifncpnmrEISLEFsrqendstdlttmadglgrncprlqniHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLdlsgssisdsgigmICNVFPNTLSRLLLALcpnitssgiqfataqlpllelmdcgmsicdptsedsnsdetCDFELQKAFNNKLHLMYQKLIIKHCClkklslwgcsgldalclncpelndlnlnscrnlrpetlllhcprlesvhasGCQELLVDTIHSqvknnpsaledqypfkrsadgskrirvphsfsq

mnnnrqhqphvspsstdyssFDFNLRPSKRRGSYNCGRCGQPKKGHSCHVGTPSTPSPPAATPAPSDSSAAISAptslsasrpprhQHYSRFRRALSFDNIDLTCESPEPDFAIEELLDPDPELSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEelrlrvppraqvgfvgsvLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKnnpsaledqypfkrsadgskrirvphsfsq

MNNNRQHQPHVSPSSTDYSSFDFNLRPSKRRGSYNCGRCGQPKKGHSCHVGtpstpsppaatpapsdssaaisaptsLSASRPPRHQHYSRFRRALSFDNIDLTCESPEPDFAIEELLDPDPELSGGLPAAALWEVLRRlpppgllaaaQVCKGWRETSrrlwraaeelrlrVPPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVlaltaaglrglrmlSLVLGSEITDASVAAIASTYSKLElldlsgssisdsgigMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQkliikhcclkklslWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKNNPSALEDQYPFKRSADGSKRIRVPHSFSQ

********************************************************************************************RRALSFDNIDLTCE*****FAIEELL*****LSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRVPPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLE************TMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICD**********TCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIH**********************************

***************************************************************************************************************************LSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRVPPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKNNPSALEDQYPFKRSADGSKRI*VP*****

******************SSFDFNLRPSKRRGSYNCGRCG************************************************YSRFRRALSFDNIDLTCESPEPDFAIEELLDPDPELSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRVPPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDP*********TCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKNNPSALEDQYPFKRSADGSKRIRVPHSFSQ

********************************SYNCGRCGQPKKGHSCHVGT***********************************************NIDLT*************LDPDPELSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRVPPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEGIFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKNNPSALEDQYPFKRSADGSKRIRVPHSF**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		541	2.2.26 [Sep-21-2011]
Q8W104		593	F-box/LRR-repeat protein	yes	no	0.975	0.890	0.585	1e-176
Q96IG2		436	F-box/LRR-repeat protein	yes	no	0.319	0.396	0.274	8e-06
Q58DG6		436	F-box/LRR-repeat protein	yes	no	0.319	0.396	0.274	8e-06
Q9QZH7		276	F-box/LRR-repeat protein	yes	no	0.319	0.626	0.274	1e-05
Q8N1E6		418	F-box/LRR-repeat protein	no	no	0.582	0.753	0.257	1e-05
Q9CZV8		436	F-box/LRR-repeat protein	yes	no	0.319	0.396	0.274	1e-05
Q8BID8		400	F-box/LRR-repeat protein	no	no	0.460	0.622	0.271	2e-05
Q17R01		400	F-box/LRR-repeat protein	no	no	0.460	0.622	0.271	2e-05
A1A5X2		489	F-box/LRR-repeat protein	no	no	0.500	0.554	0.255	5e-05
P34284		466	Uncharacterized F-box/LRR	yes	no	0.648	0.753	0.232	0.0001

>sp\|Q8W104\|FBL17_ARATH F-box/LRR-repeat protein 17 OS=Arabidopsis thaliana GN=FBL17 PE=1 SV=1	Back alignment and function desciption

 Score =  619 bits (1597), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 337/576 (58%), Positives = 398/576 (69%), Gaps = 48/576 (8%)

Query: 6   QHQPHVSPSSTD--YSSFDFNLRPSKRRGSYNCGRCGQPKKGHSCHVGTP-STPSPPAAT 62
           Q QPH+SP++     S+   + R  K RGSYNCGRCGQPKKGH C +  P   P+ P A+
Sbjct: 2   QPQPHISPNTATAAISAALESQRSRKNRGSYNCGRCGQPKKGHVCLLTAPPDIPTTPIAS 61

Query: 63  PAPS----DSSAAISAPTSLSASRPPRHQHYSRFRRALSFDNIDLTCESPEPDFAIEEL- 117
              S     +S++ S   SL+A+ P   Q ++  RRALSFD++D      E D     + 
Sbjct: 62  EPVSCISAAASSSRSTVLSLTAA-PSSRQTFTHLRRALSFDDVDARNSLDESDLDAASMD 120

Query: 118 ----LDPDPELSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRV 173
               LD D    G   A  LWEVL+RLPP  LL AA+VCKGWRETSR++W+AAEELR+RV
Sbjct: 121 LDLQLDTDIVQPGRFHAVGLWEVLKRLPPSSLLMAARVCKGWRETSRKMWKAAEELRIRV 180

Query: 174 PPRAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRI 233
           P RAQ+G++GS+LQKC  L+RLSL +ESD DAT LACIAFSCPNLE +EI TSG+AVNRI
Sbjct: 181 PERAQIGYIGSLLQKCPRLIRLSLKIESDFDATTLACIAFSCPNLEVLEITTSGAAVNRI 240

Query: 234 TGDELGRFVADKRCLASLKMEG----------------------------IFNCPNMREI 265
           +GDEL RFVA+KR L SLKMEG                            IFNCPN+ EI
Sbjct: 241 SGDELSRFVANKRGLTSLKMEGCSNLGGFSLSSSSLSTLWLSDLHSLSKMIFNCPNLTEI 300

Query: 266 SLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLV 325
           SLEFSRQE+DSTDL TM DGLGR C RLQNIHIAS++LSH+VVL+LTA   R LRMLSLV
Sbjct: 301 SLEFSRQEDDSTDLVTMVDGLGRTCTRLQNIHIASLKLSHTVVLSLTAVNFRYLRMLSLV 360

Query: 326 LGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSS 385
           LG  ITDASVAAI+S Y  LELLDLSGSSI+D+G+GMIC+V P+TLS+LL+ALCPNITSS
Sbjct: 361 LGINITDASVAAISSGYKNLELLDLSGSSITDTGLGMICDVLPDTLSKLLVALCPNITSS 420

Query: 386 GIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCC 445
           GIQFATAQLPLLELMDCGM++ DP S++    E         +N       QK+ IKH  
Sbjct: 421 GIQFATAQLPLLELMDCGMTVSDPNSDNPTFVENPSPHKTPGYN-------QKMFIKHKR 473

Query: 446 LKKLSLWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDT 505
           LKKLSLWGCS LDAL LNCPEL DLNLN C NL PE+L+L CP+L+ V+ASGCQ LL   
Sbjct: 474 LKKLSLWGCSSLDALFLNCPELMDLNLNLCSNLHPESLVLQCPKLQLVYASGCQGLLTGA 533

Query: 506 IHSQVKNNPSALEDQYPFKRSADGSKRIRVPHSFSQ 541
           I  QV  N SA E+  P KR AD SKRI+   S  Q
Sbjct: 534 IRKQVSENFSAGENHMPRKRLADASKRIQALPSLYQ 569

Essential protein for male fertility. Component of the SCF(ASK-cullin-F-box) E3 ubiquitin ligase complex SCF(FBL17), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Enables the switch in cell cycle control leading to male germ cell lineage formation from microspores after meiosis. Targets CDKA-1 inhibitors the degradation specifically in male germ cells (e.g. KRP6 and KRP7) and thus enables CDKA-1 activation and germ cell S-phase progression. Promotes twin sperm cell production and double fertilization.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q96IG2\|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2	Back alignment and function description

>sp\|Q58DG6\|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2	Back alignment and function description

>sp\|Q9QZH7\|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1	Back alignment and function description

>sp\|Q8N1E6\|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1	Back alignment and function description

>sp\|Q9CZV8\|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3	Back alignment and function description

>sp\|Q8BID8\|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1	Back alignment and function description

>sp\|Q17R01\|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1	Back alignment and function description

>sp\|A1A5X2\|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1	Back alignment and function description

>sp\|P34284\|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=4 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		541
224062247		588	predicted protein [Populus trichocarpa]	0.979	0.901	0.660	0.0
255559927		586	F-box/leucine rich repeat protein, putat	0.963	0.889	0.677	0.0
224085583		588	predicted protein [Populus trichocarpa]	0.977	0.899	0.664	0.0
225437221		574	PREDICTED: F-box/LRR-repeat protein 17 [	0.913	0.860	0.693	0.0
356536796		592	PREDICTED: F-box/LRR-repeat protein 17-l	0.933	0.853	0.634	0.0
356570612		578	PREDICTED: F-box/LRR-repeat protein 17-l	0.950	0.889	0.628	0.0
449530045		587	PREDICTED: F-box/LRR-repeat protein 17-l	0.961	0.885	0.629	1e-179
356502772		590	PREDICTED: F-box/LRR-repeat protein 17-l	0.933	0.855	0.613	1e-178
449458440		587	PREDICTED: F-box/LRR-repeat protein 17-l	0.961	0.885	0.627	1e-178
42565930		593	F-box/LRR-repeat protein 17 [Arabidopsis	0.975	0.890	0.585	1e-175

>gi\|224062247\|ref\|XP_002300803.1\| predicted protein [Populus trichocarpa] gi\|222842529\|gb\|EEE80076.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/569 (66%), Positives = 432/569 (75%), Gaps = 39/569 (6%)

Query: 6   QHQPHVSP-----SSTDYSSFDFNLRPSKRRGSYNCGRCGQPKKGHSCHVGTPSTPSPPA 60
           ++QPH+ P     S+  ++S D   R  K RG+YNCGRCG PKKGH CH+   ST +   
Sbjct: 4   ENQPHIPPATPGGSTASFTSLDIPHRVKKNRGNYNCGRCGLPKKGHVCHLPPTSTTTTTP 63

Query: 61  ATPAPSDSSAAISAPTSLSASRPPRHQHYSRFRRALSFDNIDLTCESPEPDFAIEELLDP 120
                  S +  ++      SRPP  Q YS  RRALSFD+ DL C+SPE +    E+ D 
Sbjct: 64  TQTPTDSSVSVSTS-----TSRPPPRQQYSNLRRALSFDDSDLRCDSPEVEIDESEM-DL 117

Query: 121 DPELSGGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETSRRLWRAAEELRLRVPPRAQVG 180
                G LP + +WE+LRRLPP GLLAA  VCKGWRET+RRLWRAAEELRLRVPPR+Q G
Sbjct: 118 FGSGCGKLPVSCMWEILRRLPPAGLLAAGSVCKGWRETARRLWRAAEELRLRVPPRSQPG 177

Query: 181 FVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGR 240
           FVGSVLQKC  L RL+L +ESD+D+TM ACIAFSCPNLE++EI TS +AVNRITGDELGR
Sbjct: 178 FVGSVLQKCPGLSRLNLRLESDLDSTMFACIAFSCPNLEAVEISTSETAVNRITGDELGR 237

Query: 241 FVADKRCLASLKMEG----------------------------IFNCPNMREISLEFSRQ 272
           FVADKRCL SLKMEG                            +FNCPN++EISL+FSRQ
Sbjct: 238 FVADKRCLTSLKMEGCSNLGGFVLCSSSLSTLWLSDLYCLSKMVFNCPNLKEISLDFSRQ 297

Query: 273 ENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITD 332
           ENDSTD+  M DGLGR+CPRLQN+H+AS+RLSH+ VLALTAA LRGLRMLSLVLG+EITD
Sbjct: 298 ENDSTDIIAMVDGLGRSCPRLQNVHVASVRLSHAAVLALTAANLRGLRMLSLVLGTEITD 357

Query: 333 ASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATA 392
           ASV AI+ +YSKLELLDLSGSSISDSGIGMICNVFP TLSRLLLALCPNITSSGIQFATA
Sbjct: 358 ASVVAISQSYSKLELLDLSGSSISDSGIGMICNVFPGTLSRLLLALCPNITSSGIQFATA 417

Query: 393 QLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLW 452
           QLPLLELMDCGM+ICD +S+   SDE+ DFELQ  F NKLHL+YQK+IIKH  LKKLSLW
Sbjct: 418 QLPLLELMDCGMTICDLSSQYPTSDESGDFELQTTFKNKLHLIYQKVIIKHSRLKKLSLW 477

Query: 453 GCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHASGCQELLVDTIHSQVKN 512
           GCSGLDAL LNCPEL DLNLNSC+NL PE +LL CP LESVHASGC  LL++ I SQV N
Sbjct: 478 GCSGLDALYLNCPELIDLNLNSCKNLHPERVLLQCPSLESVHASGCHNLLIEGIQSQVSN 537

Query: 513 NPSALEDQYPFKRSADGSKRIRVPHSFSQ 541
           N +A+E+Q+P KR ADGSKR+RVP   SQ
Sbjct: 538 NFAAMENQFPNKRLADGSKRVRVPQFLSQ 566

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255559927\|ref\|XP_002520982.1\| F-box/leucine rich repeat protein, putative [Ricinus communis] gi\|223539819\|gb\|EEF41399.1\| F-box/leucine rich repeat protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224085583\|ref\|XP_002307626.1\| predicted protein [Populus trichocarpa] gi\|222857075\|gb\|EEE94622.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225437221\|ref\|XP_002275262.1\| PREDICTED: F-box/LRR-repeat protein 17 [Vitis vinifera] gi\|297735494\|emb\|CBI17934.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356536796\|ref\|XP_003536920.1\| PREDICTED: F-box/LRR-repeat protein 17-like [Glycine max]	Back alignment and taxonomy information

>gi\|356570612\|ref\|XP_003553479.1\| PREDICTED: F-box/LRR-repeat protein 17-like [Glycine max]	Back alignment and taxonomy information

>gi\|449530045\|ref\|XP_004172007.1\| PREDICTED: F-box/LRR-repeat protein 17-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356502772\|ref\|XP_003520190.1\| PREDICTED: F-box/LRR-repeat protein 17-like [Glycine max]	Back alignment and taxonomy information

>gi\|449458440\|ref\|XP_004146955.1\| PREDICTED: F-box/LRR-repeat protein 17-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|42565930|ref|NP_567005.2| F-box/LRR-repeat protein 17 [Arabidopsis thaliana] gi|75331246|sp|Q8W104.1|FBL17_ARATH RecName: Full=F-box/LRR-repeat protein 17; AltName: Full=F-box-like protein 17 gi|18087570|gb|AAL58916.1|AF462827_1 AT3g54650/T5N23_10 [Arabidopsis thaliana] gi|22655356|gb|AAM98270.1| At3g54650/T5N23_10 [Arabidopsis thaliana] gi|332645740|gb|AEE79261.1| F-box/LRR-repeat protein 17 [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		541
TAIR\|locus:2102400		593	FBL17 "AT3G54650" [Arabidopsis	0.515	0.470	0.559	6e-133

TAIR\|locus:2102400 FBL17 "AT3G54650" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 761 (272.9 bits), Expect = 6.0e-133, Sum P(2) = 6.0e-133
 Identities = 160/286 (55%), Positives = 186/286 (65%)

Query:   256 IFNCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVXXXXXXX 315
             IFNCPN+ EISLEFSRQE+DSTDL TM DGLGR C RLQNIHIAS++LSH+VV       
Sbjct:   291 IFNCPNLTEISLEFSRQEDDSTDLVTMVDGLGRTCTRLQNIHIASLKLSHTVVLSLTAVN 350

Query:   316 XXXXXXXSLVLGSEITDASVAAIASTYSKLEXXXXXXXXXXXXXXXMICNVFPNTLSRLL 375
                    SLVLG  ITDASVAAI+S Y  LE               MIC+V P+TLS+LL
Sbjct:   351 FRYLRMLSLVLGINITDASVAAISSGYKNLELLDLSGSSITDTGLGMICDVLPDTLSKLL 410

Query:   376 LALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNNKLHLM 435
             +ALCPNITSSGIQFATAQLPLLELMDCGM++ DP S++    E         +N K+ + 
Sbjct:   411 VALCPNITSSGIQFATAQLPLLELMDCGMTVSDPNSDNPTFVENPSPHKTPGYNQKMFIK 470

Query:   436 YQXXXXXXXXXXXXXXWGCSGLDALCLNCPELNDLNLNSCRNLRPETLLLHCPRLESVHA 495
             ++              WGCS LDAL LNCPEL DLNLN C NL PE+L+L CP+L+ V+A
Sbjct:   471 HKRLKKLSL-------WGCSSLDALFLNCPELMDLNLNLCSNLHPESLVLQCPKLQLVYA 523

Query:   496 SGCQELLVDTIHSQVKNNPSALEDQYPFKRSADGSKRIRVPHSFSQ 541
             SGCQ LL   I  QV  N SA E+  P KR AD SKRI+   S  Q
Sbjct:   524 SGCQGLLTGAIRKQVSENFSAGENHMPRKRLADASKRIQALPSLYQ 569

GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS

GO:0009507 "chloroplast" evidence=ISM

GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS

GO:0001673 "male germ cell nucleus" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0019005 "SCF ubiquitin ligase complex" evidence=IDA

GO:0031146 "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=IDA

GO:0009555 "pollen development" evidence=IMP

GO:0009790 "embryo development" evidence=IMP

GO:0048316 "seed development" evidence=IMP

GO:0055047 "generative cell mitosis" evidence=IMP

GO:0006261 "DNA-dependent DNA replication" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8W104	FBL17_ARATH	No assigned EC number	0.5850	0.9759	0.8903	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_II000418	hypothetical protein (588 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		541
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	3e-08
pfam12937		47	pfam12937, F-box-like, F-box-like	3e-04
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	0.003

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

 Score = 53.9 bits (130), Expect = 3e-08
 Identities = 36/150 (24%), Positives = 59/150 (39%), Gaps = 33/150 (22%)

Query: 258 NCPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLR 317
           +CPN++ + L       DS  +      L  NCP+LQ I++   R  H            
Sbjct: 76  SCPNLQVLDLRACENITDSGIVA-----LATNCPKLQTINLGRHRNGHL----------- 119

Query: 318 GLRMLSLVLGSEITDASVAAIASTYSKLELLDLSGSSISDSGIGMICNVFPNTLSRLLLA 377
                       ITD S++A+    + L+ +  +G  ++D G+  + +    +L RL L 
Sbjct: 120 ------------ITDVSLSALGKNCTFLQTVGFAGCDVTDKGVWELASGCSKSLERLSLN 167

Query: 378 LCPNITSSGIQF-----ATAQLPLLELMDC 402
            C N+T   I           L +LE   C
Sbjct: 168 NCRNLTDQSIPAILASNYFPNLSVLEFRGC 197

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl\|CDD\|221867 pfam12937, F-box-like, F-box-like	Back alignment and domain information

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		541
KOG4341		483	consensus F-box protein containing LRR [General fu	100.0
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.92
KOG4341		483	consensus F-box protein containing LRR [General fu	99.86
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.62
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.58
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.54
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.51
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.49
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.46
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.4
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.34
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.27
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.24
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.23
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.17
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.11
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.9
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.76
PF12937		47	F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B	98.66
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.57
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.51
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.4
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.39
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.35
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.33
smart00256		41	FBOX A Receptor for Ubiquitination Targets.	98.25
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.25
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.2
KOG3864		221	consensus Uncharacterized conserved protein [Funct	98.18
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.12
PF00646		48	F-box: F-box domain; InterPro: IPR001810 The F-box	98.08
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.0
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.91
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.9
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.85
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.83
KOG3864		221	consensus Uncharacterized conserved protein [Funct	97.76
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.76
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.7
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.51
KOG4237		498	consensus Extracellular matrix protein slit, conta	97.26
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	97.22
KOG0472		565	consensus Leucine-rich repeat protein [Function un	97.16
KOG4237		498	consensus Extracellular matrix protein slit, conta	97.15
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	97.11
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.08
KOG4308		478	consensus LRR-containing protein [Function unknown	97.06
KOG4308		478	consensus LRR-containing protein [Function unknown	96.7
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	96.62
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	96.31
PRK15386		426	type III secretion protein GogB; Provisional	96.18
KOG2997		366	consensus F-box protein FBX9 [General function pre	96.18
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.18
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.16
KOG0472		565	consensus Leucine-rich repeat protein [Function un	96.03
PLN03150		623	hypothetical protein; Provisional	95.91
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	95.9
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	95.85
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	95.83
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	95.32
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.23
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.21
KOG0617		264	consensus Ras suppressor protein (contains leucine	95.12
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	95.12
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.06
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	94.85
PRK15386		426	type III secretion protein GogB; Provisional	94.84
KOG0617		264	consensus Ras suppressor protein (contains leucine	94.77
PLN03150		623	hypothetical protein; Provisional	94.63
PLN03215		373	ascorbic acid mannose pathway regulator 1; Provisi	94.38
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	93.85
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	93.79
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	93.34
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	92.91
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	92.35
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	90.36
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	87.55
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	85.18
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	84.03
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	80.18

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=2e-35  Score=284.81  Aligned_cols=354  Identities=24%  Similarity=0.340  Sum_probs=271.4

Q ss_pred             CCCCHHHHHHHHhcCChhhHHHHHHHHHHHHHhh--HHHHhhcccccccCCCCcchhhHHHHHhhCC-CccEEEecCCCC
Q 045871          126 GGLPAAALWEVLRRLPPPGLLAAAQVCKGWRETS--RRLWRAAEELRLRVPPRAQVGFVGSVLQKCS-ALVRLSLTMESD  202 (541)
Q Consensus       126 ~~LP~eil~~If~~L~~~~l~~~~~Vck~W~~~~--~~~~~~i~~~~l~~~~~~~~~~l~~l~~~~~-~L~~L~L~~~~~  202 (541)
                      ..||+|++..||++|+.+.+++++++|+.|+..+  +..|++++++.++  .++...++..++++|. .|++|.++||..
T Consensus        73 ~~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~--rDv~g~VV~~~~~Rcgg~lk~LSlrG~r~  150 (483)
T KOG4341|consen   73 RSLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQ--RDVDGGVVENMISRCGGFLKELSLRGCRA  150 (483)
T ss_pred             ccCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcch--hcCCCcceehHhhhhcccccccccccccc
Confidence            5679999999999999999999999999999999  9999999999887  4566788999999998 599999999999


Q ss_pred             CChhhHHHHhhcCCCccEEEeeecCCcccccCHHHHHHHHhhCCCCceeeecC------------ccCCCCcceEEeccc
Q 045871          203 VDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELGRFVADKRCLASLKMEG------------IFNCPNMREISLEFS  270 (541)
Q Consensus       203 ~~~~~L~~l~~~~~~L~~L~L~~c~~~~~~it~~~l~~~~~~~~~L~~L~l~~------------~~~~~~L~~L~L~~~  270 (541)
                      +.+..+..+..+|||+++|+|.+|.    .+|+..+..+.+.|++|++|.+.+            ...|++|++|++++|
T Consensus       151 v~~sslrt~~~~CpnIehL~l~gc~----~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc  226 (483)
T KOG4341|consen  151 VGDSSLRTFASNCPNIEHLALYGCK----KITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWC  226 (483)
T ss_pred             CCcchhhHHhhhCCchhhhhhhcce----eccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccC
Confidence            9999999999999999999999997    799999999988888887777765            235677777777777


Q ss_pred             CCCCCchhHHHHHHHHhcCCCCCCeEEecCcccchHHHHHHHHhcCCCCCEEEcCCCCCCCHHHHHHHHhcCCCccEEEe
Q 045871          271 RQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAIASTYSKLELLDL  350 (541)
Q Consensus       271 ~~~~~~~~l~~l~~~l~~~~~~L~~L~l~~~~i~~~~~~~l~~~~~~~L~~L~L~~~~~i~d~~l~~l~~~~~~L~~L~L  350 (541)
                      ..+.+..     ++.+.+++..++.+.+.+|.-.+...+..+..+++.+.++++..|..+||+++..+..+|..|+.|+.
T Consensus       227 ~qi~~~g-----v~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~  301 (483)
T KOG4341|consen  227 PQISGNG-----VQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCY  301 (483)
T ss_pred             chhhcCc-----chHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcc
Confidence            6666532     33455566666666666664333322333335666666666667777777777777777777777777


Q ss_pred             cCC-CCChHHHHHHHhhCCCCccEEeccCCCCCCHHHHHHHHhcCCCcceecccCCcCCCCCCCCCCcccccceeecccc
Q 045871          351 SGS-SISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFN  429 (541)
Q Consensus       351 ~~~-~i~~~~l~~l~~~~~~~L~~L~l~~c~~l~~~~l~~l~~~~~~L~~l~~~~~~~~~~~~~~~~~~~~l~~L~l~~c  429 (541)
                      +++ .++|..+..+...++ +|+.|-+..|..+++.++..++.+|+.|+.++                        +..|
T Consensus       302 s~~t~~~d~~l~aLg~~~~-~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~------------------------~e~~  356 (483)
T KOG4341|consen  302 SSCTDITDEVLWALGQHCH-NLQVLELSGCQQFSDRGFTMLGRNCPHLERLD------------------------LEEC  356 (483)
T ss_pred             cCCCCCchHHHHHHhcCCC-ceEEEeccccchhhhhhhhhhhcCChhhhhhc------------------------cccc
Confidence            776 677777777777763 67777777777777777777777777776665                        3334


Q ss_pred             hhhcH-HHHHHHHhCCCccEEEcCCCccH-----HHHH---hcCCCCCeeeccCCCCCCHhHH--HhcCCCCcEecccCC
Q 045871          430 NKLHL-MYQKLIIKHCCLKKLSLWGCSGL-----DALC---LNCPELNDLNLNSCRNLRPETL--LLHCPRLESVHASGC  498 (541)
Q Consensus       430 ~~l~~-~~~~~l~~~~~L~~L~L~~~~~l-----~~l~---~~~~~L~~L~L~~c~~~~d~~l--~~~~p~L~~L~l~~C  498 (541)
                      ..+.+ .+..+..+|+.|++|.|+.|+.+     ..+.   .....|+.|.|++|+.++|+.+  ...|++|+.+++.+|
T Consensus       357 ~~~~d~tL~sls~~C~~lr~lslshce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~l~~c~~Leri~l~~~  436 (483)
T KOG4341|consen  357 GLITDGTLASLSRNCPRLRVLSLSHCELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEHLSICRNLERIELIDC  436 (483)
T ss_pred             ceehhhhHhhhccCCchhccCChhhhhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHHHhhCcccceeeeech
Confidence            44443 35556677899999999988633     2222   2356899999999999999544  578999999999999


Q ss_pred             ccccHHHHHHhHhcCcc
Q 045871          499 QELLVDTIHSQVKNNPS  515 (541)
Q Consensus       499 ~~it~~~i~~~~~~~~~  515 (541)
                      .+++.++|+.++-.-+.
T Consensus       437 q~vtk~~i~~~~~~lp~  453 (483)
T KOG4341|consen  437 QDVTKEAISRFATHLPN  453 (483)
T ss_pred             hhhhhhhhHHHHhhCcc
Confidence            99999999998866544

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>smart00256 FBOX A Receptor for Ubiquitination Targets	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG2997 consensus F-box protein FBX9 [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		541
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	9e-22
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-21
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-20
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-15
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-14
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-13
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-09
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-19
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-18
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	7e-16
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-15
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	6e-13
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-18
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	6e-18
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-14
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	6e-07
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-06
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-06
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	6e-08
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	3e-05
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	2e-07
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	1e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	7e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	4e-07
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	4e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	4e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	6e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	7e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	8e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-05
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-04
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	3e-04

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

 Score = 98.0 bits (244), Expect = 9e-22
 Identities = 58/380 (15%), Positives = 117/380 (30%), Gaps = 72/380 (18%)

Query: 182 VGSVLQKCSALVRLSL--TMESDVDATMLACIAFSCPNLESMEIYTSGSAVNRITGDELG 239
           + ++   C  L  L L  +   DV    L+    +  +L S+ I       + ++   L 
Sbjct: 148 LAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNI---SCLASEVSFSALE 204

Query: 240 RFVADKRCLASLKMEG----------IFNCPNMREISLEFSRQENDSTDLTTMAD----- 284
           R V     L SLK+            +   P + E+       E      + ++      
Sbjct: 205 RLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGC 264

Query: 285 ------------------GLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVL 326
                              +   C RL  ++++   +    ++ L       L+   L +
Sbjct: 265 KELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKL-LCQCPKLQ--RLWV 321

Query: 327 GSEITDASVAAIASTYSKLELLDLSG---------SSISDSGIGMICNVFPNTLSRLLLA 377
              I DA +  +AST   L  L +            ++++ G+  +    P      +L 
Sbjct: 322 LDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKL--ESVLY 379

Query: 378 LCPNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNSDETCDFELQKAFNN-----KL 432
            C  +T++ +       P +      + I +P + D  + E  D        +     +L
Sbjct: 380 FCRQMTNAALITIARNRPNMTRFR--LCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRL 437

Query: 433 HLMYQ------KLIIKHC-CLKKLSLWGCS----GLDALCLNCPELNDLNLNSCRNLRP- 480
            L         + I  +   ++ LS+        G+  +   C  L  L +  C      
Sbjct: 438 SLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKA 497

Query: 481 -ETLLLHCPRLESVHASGCQ 499
                     + S+  S C 
Sbjct: 498 LLANASKLETMRSLWMSSCS 517

PyMOL of 2p1m

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		541
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.97
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.97
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.94
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.89
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.87
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.85
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.85
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.76
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.75
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.71
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.69
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.62
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.58
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.56
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.55
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.54
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.52
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.51
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.51
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.5
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.46
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.44
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.44
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.42
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.42
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.41
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.41
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.4
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.39
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.38
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.38
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.38
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.37
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.36
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.36
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.35
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.35
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.34
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.34
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.31
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.31
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.3
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.3
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.29
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.28
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.27
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.27
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.25
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.24
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.24
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.23
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.23
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.22
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.22
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.21
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.21
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.18
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.18
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.18
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.17
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.16
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.16
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.16
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.13
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.12
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.11
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.11
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.1
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.1
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.08
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.01
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	99.0
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.0
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.0
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.99
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.99
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.98
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.97
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.95
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.93
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.91
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.91
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.9
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.89
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.89
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.89
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.87
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.87
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.84
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.82
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.8
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.79
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.78
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.75
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.73
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	98.72
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.71
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.68
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.59
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.58
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.55
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.55
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.54
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.51
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.46
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.46
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.44
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.44
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.4
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.39
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.33
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.31
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.31
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.22
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.19
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.19
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.17
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.15
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.13
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.12
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.12
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.1
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.0
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	97.99
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.98
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	97.97
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.96
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.94
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.93
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	97.87
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.87
3l2o_B		312	F-box only protein 4; small G protein fold, UBL co	97.82
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.78
2e31_A		297	FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui	97.77
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.43
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.41
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.4
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.38
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.37
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.3
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.29
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	97.24
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.11
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.04
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	97.01
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	96.85
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	96.78
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	96.72
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.6
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.32
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.29
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.26
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.24
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	96.02
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	95.0
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	94.36
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	94.25
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	84.44
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	82.35

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

Probab=99.97  E-value=2.1e-30  Score=281.42  Aligned_cols=374  Identities=15%  Similarity=0.153  Sum_probs=231.6

Q ss_pred             CCCCHHHHHHHHhcC-ChhhHHHHHHHHHHHHHhhHHHHhhccc--------------------ccccCCC---------
Q 045871          126 GGLPAAALWEVLRRL-PPPGLLAAAQVCKGWRETSRRLWRAAEE--------------------LRLRVPP---------  175 (541)
Q Consensus       126 ~~LP~eil~~If~~L-~~~~l~~~~~Vck~W~~~~~~~~~~i~~--------------------~~l~~~~---------  175 (541)
                      ..||+|+|.+||+|| +.+|+.+++.|||+|+.+....|..+..                    +.+...+         
T Consensus        14 ~~LPdeil~~I~~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~   93 (592)
T 3ogk_B           14 VATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIP   93 (592)
T ss_dssp             CCCGGGTHHHHHTTCCCHHHHHHHTTSCHHHHHHHHHHCCEEEESCGGGSCHHHHHHHCTTCSEEEEECSCGGGGGTCSC
T ss_pred             CCCCHHHHHHHHHhcCCHHHHHHHHHHhHHHHHhhhccccEEEEeeccccChHHHHHhCCCCeEEEecCCcchhhccccc
Confidence            457999999999999 7999999999999999986433332221                    0111000         


Q ss_pred             ----CcchhhHHHHHhhCCCccEEEecCCCCCChhhHHHHhhcCCC-ccEEEeeecCCcccccCHHHHHHHHhhCCCCce
Q 045871          176 ----RAQVGFVGSVLQKCSALVRLSLTMESDVDATMLACIAFSCPN-LESMEIYTSGSAVNRITGDELGRFVADKRCLAS  250 (541)
Q Consensus       176 ----~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~L~~l~~~~~~-L~~L~L~~c~~~~~~it~~~l~~~~~~~~~L~~  250 (541)
                          ......+..+...+++|++|+|+++ .+++..+..+...+++ |++|+|++|.    .++..++..+...+++|+.
T Consensus        94 ~~~~~~~~~~l~~l~~~~~~L~~L~L~~~-~i~~~~~~~l~~~~~~~L~~L~L~~~~----~~~~~~l~~~~~~~~~L~~  168 (592)
T 3ogk_B           94 ENWGGYVTPWVTEISNNLRQLKSVHFRRM-IVSDLDLDRLAKARADDLETLKLDKCS----GFTTDGLLSIVTHCRKIKT  168 (592)
T ss_dssp             TTSCCBCHHHHHHHHHHCTTCCEEEEESC-BCCHHHHHHHHHHHGGGCCEEEEESCE----EEEHHHHHHHHHHCTTCSE
T ss_pred             ccccccchHHHHHHHhhCCCCCeEEeecc-EecHHHHHHHHHhccccCcEEECcCCC----CcCHHHHHHHHhhCCCCCE
Confidence                0011235555666777777777764 4566666655555544 6666666654    3555555555555666666


Q ss_pred             eeecCc--------------cCCCCcceEEecccCCCC-CchhHHHH---------------------------------
Q 045871          251 LKMEGI--------------FNCPNMREISLEFSRQEN-DSTDLTTM---------------------------------  282 (541)
Q Consensus       251 L~l~~~--------------~~~~~L~~L~L~~~~~~~-~~~~l~~l---------------------------------  282 (541)
                      |.+.+.              ..+++|++|+++++.... +...+..+                                 
T Consensus       169 L~L~~~~~~~~~~~~l~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~l~~~~~~~~~L~~L  248 (592)
T 3ogk_B          169 LLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEF  248 (592)
T ss_dssp             EECTTCEEECCCSHHHHHHHHHCCCCCEEECTTCCCSSCCHHHHHHHHHHCTTCCEEECSSCBGGGGHHHHHHCTTCCEE
T ss_pred             EECccccccCcchhHHHHHHhcCCCccEEEeeccCCCccCHHHHHHHHhhCCCCcEEeccCccHHHHHHHHhhhhHHHhh
Confidence            665541              123444444443322110 00011000                                 


Q ss_pred             ------------------------------------HHHHhcCCCCCCeEEecCcccchHHHHHHHHhcCCCCCEEEcCC
Q 045871          283 ------------------------------------ADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVL  326 (541)
Q Consensus       283 ------------------------------------~~~l~~~~~~L~~L~l~~~~i~~~~~~~l~~~~~~~L~~L~L~~  326 (541)
                                                          +..+...+++|++|++++|.+.+..+..++ ..+++|++|+|. 
T Consensus       249 ~l~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~Ls~~~l~~~~~~~~~-~~~~~L~~L~L~-  326 (592)
T 3ogk_B          249 CGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLI-QKCPNLEVLETR-  326 (592)
T ss_dssp             EECBCCCCTTCTTSSSCCCCCTTCCEEEETTCCTTTGGGGGGGGGGCCEEEETTCCCCHHHHHHHH-TTCTTCCEEEEE-
T ss_pred             cccccccccchHHHHHHhhccccccccCccccchhHHHHHHhhcCCCcEEecCCCcCCHHHHHHHH-HhCcCCCEEecc-
Confidence                                                111122455666666666666555554443 567777777776 


Q ss_pred             CCCCCHHHHHHHHhcCCCccEEEecC----------C-CCChHHHHHHHhhCCCCccEEeccCCCCCCHHHHHHHHhcCC
Q 045871          327 GSEITDASVAAIASTYSKLELLDLSG----------S-SISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLP  395 (541)
Q Consensus       327 ~~~i~d~~l~~l~~~~~~L~~L~L~~----------~-~i~~~~l~~l~~~~~~~L~~L~l~~c~~l~~~~l~~l~~~~~  395 (541)
                       ..+++.++..+...|++|++|+|++          | .+++.++..+...| ++|++|++ .|..+++.++..++..|+
T Consensus       327 -~~~~~~~l~~~~~~~~~L~~L~L~~g~~~~~~~~~~~~~~~~~~~~l~~~~-~~L~~L~l-~~~~l~~~~~~~l~~~~~  403 (592)
T 3ogk_B          327 -NVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGC-QELEYMAV-YVSDITNESLESIGTYLK  403 (592)
T ss_dssp             -GGGHHHHHHHHHHHCTTCCEEEEECCCCSSTTSSTTCCCCHHHHHHHHHHC-TTCSEEEE-EESCCCHHHHHHHHHHCC
T ss_pred             -CccCHHHHHHHHHhCCCCCEEEeecCccccccccccCccCHHHHHHHHhhC-ccCeEEEe-ecCCccHHHHHHHHhhCC
Confidence             3466677777767777777777773          4 77777777777666 47888877 556777777777777778


Q ss_pred             CcceecccCC-cCCCCCCCCC--------Ccccccceeecccchh-hcHHHHHHHHh-CCCccEEEcCCCc----cHHHH
Q 045871          396 LLELMDCGMS-ICDPTSEDSN--------SDETCDFELQKAFNNK-LHLMYQKLIIK-HCCLKKLSLWGCS----GLDAL  460 (541)
Q Consensus       396 ~L~~l~~~~~-~~~~~~~~~~--------~~~~~l~~L~l~~c~~-l~~~~~~~l~~-~~~L~~L~L~~~~----~l~~l  460 (541)
                      +|+.|++... .|+.......        .....+++|+|++|.. +++.....+.. +++|+.|+|++|.    ++..+
T Consensus       404 ~L~~L~l~~~~~~n~l~~~p~~~~~~~~~~~~~~L~~L~L~~~~~~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~  483 (592)
T 3ogk_B          404 NLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEF  483 (592)
T ss_dssp             SCCEEEEEECSCCSCCSSCCCHHHHHHHHHHCTTCCEEEEECCGGGCCHHHHHHHHHSCTTCCEEEECSCCSSHHHHHHH
T ss_pred             CCcEEEEeecCCCccccCchHHHHHHHHHHhCCCCCEEEEecCCCCccHHHHHHHHHhCccceEeeccCCCCCHHHHHHH
Confidence            8887775321 1333333211        1123468888888764 55555554444 7888888888874    45667


Q ss_pred             HhcCCCCCeeeccCCCCCCHh---HHHhcCCCCcEecccCCccccHHHHHHhHh
Q 045871          461 CLNCPELNDLNLNSCRNLRPE---TLLLHCPRLESVHASGCQELLVDTIHSQVK  511 (541)
Q Consensus       461 ~~~~~~L~~L~L~~c~~~~d~---~l~~~~p~L~~L~l~~C~~it~~~i~~~~~  511 (541)
                      ...|++|++|+|++|. +++.   .+...+++|+.|+|++|. +++.+++.+..
T Consensus       484 ~~~~~~L~~L~l~~n~-l~~~~~~~~~~~l~~L~~L~ls~n~-it~~~~~~l~~  535 (592)
T 3ogk_B          484 SRGCPNLQKLEMRGCC-FSERAIAAAVTKLPSLRYLWVQGYR-ASMTGQDLMQM  535 (592)
T ss_dssp             HTCCTTCCEEEEESCC-CBHHHHHHHHHHCSSCCEEEEESCB-CCTTCTTGGGG
T ss_pred             HhcCcccCeeeccCCC-CcHHHHHHHHHhcCccCeeECcCCc-CCHHHHHHHHH
Confidence            7788888888888888 6663   344678888888888888 88877766653

PyMOL of 3ogk

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		541
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	3e-07
d1fs1a1		41	a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [	5e-05
d1p22a1		118	a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b	0.002

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 50.1 bits (118), Expect = 3e-07
 Identities = 41/219 (18%), Positives = 77/219 (35%), Gaps = 14/219 (6%)

Query: 292 RLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVL-GSEITDASVAAIASTYSKLELLDL 350
           RL +  + + R   S +    A      R+  + L  S I  +++  I S  SKL+ L L
Sbjct: 19  RLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSL 78

Query: 351 SGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMSICDPT 410
            G  +SD  +  +     + L RL L+ C   +   +Q   +    L+ ++         
Sbjct: 79  EGLRLSDPIVNTLAKN--SNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTE 136

Query: 411 SEDSNSDETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGC---------SGLDALC 461
                +       + +   +      QK  +     +  +L            +      
Sbjct: 137 KHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEF 196

Query: 462 LNCPELNDLNLNSCRNLRPETL--LLHCPRLESVHASGC 498
                L  L+L+ C ++ PETL  L   P L+++   G 
Sbjct: 197 FQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI 235

PyMOL of d2astb2

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41	Back information, alignment and structure

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		541
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.86
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.83
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.62
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.58
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.54
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.49
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.22
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.05
d1fs1a1		41	Skp2 {Human (Homo sapiens) [TaxId: 9606]}	98.95
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.8
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.76
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.75
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.72
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.69
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.66
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.66
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.65
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.65
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.64
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.63
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.58
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.58
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.43
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.43
d1nexb1		100	Cdc4 F-box and linker domains {Baker's yeast (Sacc	98.41
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.39
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.33
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.31
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.29
d2ovrb1		102	F-box/WD repeat-containing protein 7, FBXW7 {Human	98.27
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.22
d1p22a1		118	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	98.17
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.02
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.92
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.87
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.85
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.8
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.73
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.54
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.37
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.14
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.11
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.92
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	96.82
d2ifga3		156	High affinity nerve growth factor receptor, N-term	96.09
d2ifga3		156	High affinity nerve growth factor receptor, N-term	95.34
d2dj7a2		36	Actin-binding LIM protein 3, abLIM-3 {Human (Homo	91.06

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=5.6e-21  Score=185.14  Aligned_cols=198  Identities=23%  Similarity=0.264  Sum_probs=120.4

Q ss_pred             CCCcceEEecccCCCCCchhHHHHHHHHhcCCCCCCeEEecCcccchHHHHHHHHhcCCCCCEEEcCCCCCCCHHHHHHH
Q 045871          259 CPNMREISLEFSRQENDSTDLTTMADGLGRNCPRLQNIHIASIRLSHSVVLALTAAGLRGLRMLSLVLGSEITDASVAAI  338 (541)
Q Consensus       259 ~~~L~~L~L~~~~~~~~~~~l~~l~~~l~~~~~~L~~L~l~~~~i~~~~~~~l~~~~~~~L~~L~L~~~~~i~d~~l~~l  338 (541)
                      ..+|++|++++|.. ++. .    +..+...|++|++|++++|.+++.....+  ..+++|++|+|++|..++|.++..+
T Consensus        45 ~~~L~~LdLs~~~i-~~~-~----l~~l~~~c~~L~~L~L~~~~l~~~~~~~l--~~~~~L~~L~Ls~c~~itd~~l~~l  116 (284)
T d2astb2          45 PFRVQHMDLSNSVI-EVS-T----LHGILSQCSKLQNLSLEGLRLSDPIVNTL--AKNSNLVRLNLSGCSGFSEFALQTL  116 (284)
T ss_dssp             CBCCCEEECTTCEE-CHH-H----HHHHHTTBCCCSEEECTTCBCCHHHHHHH--TTCTTCSEEECTTCBSCCHHHHHHH
T ss_pred             CCCCCEEECCCCcc-CHH-H----HHHHHHhCCCcccccccccCCCcHHHHHH--hcCCCCcCccccccccccccccchh
Confidence            45677777776532 221 1    33445577778888888777777666665  3577788888877777777777777


Q ss_pred             HhcCCCccEEEecCC-CCChHHHHHHHhhCCCCccEEeccCC-CCCCHHHHHHHHhcCCCcceecccCCcCCCCCCCCCC
Q 045871          339 ASTYSKLELLDLSGS-SISDSGIGMICNVFPNTLSRLLLALC-PNITSSGIQFATAQLPLLELMDCGMSICDPTSEDSNS  416 (541)
Q Consensus       339 ~~~~~~L~~L~L~~~-~i~~~~l~~l~~~~~~~L~~L~l~~c-~~l~~~~l~~l~~~~~~L~~l~~~~~~~~~~~~~~~~  416 (541)
                      +.+|++|++|++++| .+++.++........++|+.|++.+| ..+++.++..++..|++|+.|+               
T Consensus       117 ~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~---------------  181 (284)
T d2astb2         117 LSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLD---------------  181 (284)
T ss_dssp             HHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEE---------------
T ss_pred             hHHHHhccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccc---------------
Confidence            777778888888777 77777775544333247788887776 3577777777777777766665               


Q ss_pred             cccccceeecccchhhcHHHHHHHHhCCCccEEEcCCCcc-----HHHHHhcCCCCCeeeccCCCCCCH---hHHHhcCC
Q 045871          417 DETCDFELQKAFNNKLHLMYQKLIIKHCCLKKLSLWGCSG-----LDALCLNCPELNDLNLNSCRNLRP---ETLLLHCP  488 (541)
Q Consensus       417 ~~~~l~~L~l~~c~~l~~~~~~~l~~~~~L~~L~L~~~~~-----l~~l~~~~~~L~~L~L~~c~~~~d---~~l~~~~p  488 (541)
                               |++|..+++.....+.++++|++|+|++|..     +..+ ..+++|++|++.+|  ++|   ..+...||
T Consensus       182 ---------L~~~~~itd~~~~~l~~~~~L~~L~L~~C~~i~~~~l~~L-~~~~~L~~L~l~~~--~~d~~l~~l~~~lp  249 (284)
T d2astb2         182 ---------LSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLEL-GEIPTLKTLQVFGI--VPDGTLQLLKEALP  249 (284)
T ss_dssp             ---------CTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGGGGGGG-GGCTTCCEEECTTS--SCTTCHHHHHHHST
T ss_pred             ---------cccccCCCchhhhhhcccCcCCEEECCCCCCCChHHHHHH-hcCCCCCEEeeeCC--CCHHHHHHHHHhCc
Confidence                     2333333333333344555555555555532     2222 23555666655555  333   23334455


Q ss_pred             CCc
Q 045871          489 RLE  491 (541)
Q Consensus       489 ~L~  491 (541)
                      +|+
T Consensus       250 ~L~  252 (284)
T d2astb2         250 HLQ  252 (284)
T ss_dssp             TSE
T ss_pred             ccc
Confidence            554

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure