Citrus Sinensis ID: 045881


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MAGGGRQFIGFTIIIFLLLLASESSAIIMGEDEYIESKQGCEYVFTAFPYCLEFLTGLYYKPSRKCCNHIKKLNMIAKHRKGNAQRFCYCIEAMVRGTQPPLLASRIQQLPITCNTSLSFPISASMDCSQ
ccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcHHcHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccc
******QFIGFTIIIFLLLLASESSAIIMGEDEYIESKQGCEYVFTAFPYCLEFLTGLYYKPSRKCCNHIKKLNMIAKHRKGNAQRFCYCIEAMVRGTQPPLLASRIQQLPITCNTSLSFPISASMDC**
xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGGGRQFIGFTIIIFLLLLASESSAIIMGEDEYIESKQGCEYVFTAFPYCLEFLTGLYYKPSRKCCNHIKKLNMIAKHRKGNAQRFCYCIEAMVRGTQPPLLASRIQQLPITCNTSLSFPISASMDCSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Non-specific lipid-transfer protein 13 Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.probableA8MQA2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LJO, chain A
Confidence level:very confident
Coverage over the Query: 38-130
View the alignment between query and template
View the model in PyMOL