Citrus Sinensis ID: 045936


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MMIGAEGASSSKKARISENPVSKNRPYFALVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIEATKAMRAMKVESKIVGVTSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEELQKN
cccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHccccccEEEEccccccHHHHHHHHccccccccccccHHHHHHHHHHHHcc
*************************PYFALVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIEATKAMRAMKVESKIVGVTSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEELQK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMIGAEGASSSKKARISENPVSKNRPYFALVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIEATKAMRAMKVESKIVGVTSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEELQKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Two-component response regulator ARR22 Functions as response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling.probableQ9M8Y4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KYJ, chain B
Confidence level:very confident
Coverage over the Query: 24-143
View the alignment between query and template
View the model in PyMOL