Citrus Sinensis ID: 045936
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 145 | ||||||
| 225430668 | 130 | PREDICTED: two-component response regula | 0.806 | 0.9 | 0.547 | 2e-33 | |
| 225430664 | 131 | PREDICTED: two-component response regula | 0.8 | 0.885 | 0.543 | 5e-32 | |
| 225430645 | 140 | PREDICTED: two-component response regula | 0.944 | 0.978 | 0.453 | 3e-31 | |
| 297833110 | 137 | hypothetical protein ARALYDRAFT_477689 [ | 0.779 | 0.824 | 0.535 | 2e-26 | |
| 15229263 | 142 | two-component response regulator ARR22 [ | 0.827 | 0.845 | 0.516 | 1e-25 | |
| 224105501 | 129 | extra response regulator [Populus tricho | 0.806 | 0.906 | 0.487 | 2e-25 | |
| 255560269 | 148 | sensory transduction histidine kinase ba | 0.924 | 0.905 | 0.427 | 4e-25 | |
| 356503660 | 132 | PREDICTED: two-component response regula | 0.793 | 0.871 | 0.486 | 8e-25 | |
| 356570702 | 150 | PREDICTED: two-component response regula | 0.917 | 0.886 | 0.437 | 1e-24 | |
| 30690228 | 139 | response regulator 24 [Arabidopsis thali | 0.793 | 0.827 | 0.469 | 2e-24 |
| >gi|225430668|ref|XP_002268738.1| PREDICTED: two-component response regulator ARR22 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 147 bits (370), Expect = 2e-33, Method: Compositional matrix adjust.
Identities = 64/117 (54%), Positives = 90/117 (76%)
Query: 29 ALVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIE 88
L+VDDDP+ RRIH ++L VG + + ENGKEAVDL+R+GA F ++ +D+EMP+MDG +
Sbjct: 13 TLIVDDDPLTRRIHKVLLTKVGLETQAVENGKEAVDLYRSGASFDLILMDLEMPIMDGPK 72
Query: 89 ATKAMRAMKVESKIVGVTSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEELQKN 145
ATK +RAM V+S IVGVT+R+ E E+++FM +GLD CY KPLT + L+E+L K+
Sbjct: 73 ATKELRAMGVQSMIVGVTARDLEVEKQMFMASGLDDCYVKPLTTDTVTALVEKLNKD 129
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225430664|ref|XP_002268656.1| PREDICTED: two-component response regulator ARR22 [Vitis vinifera] gi|147770071|emb|CAN76616.1| hypothetical protein VITISV_013274 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225430645|ref|XP_002269033.1| PREDICTED: two-component response regulator ARR22 [Vitis vinifera] gi|296085160|emb|CBI28655.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297833110|ref|XP_002884437.1| hypothetical protein ARALYDRAFT_477689 [Arabidopsis lyrata subsp. lyrata] gi|297330277|gb|EFH60696.1| hypothetical protein ARALYDRAFT_477689 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15229263|ref|NP_187078.1| two-component response regulator ARR22 [Arabidopsis thaliana] gi|30679083|ref|NP_850511.1| two-component response regulator ARR22 [Arabidopsis thaliana] gi|145331750|ref|NP_001078102.1| two-component response regulator ARR22 [Arabidopsis thaliana] gi|51316101|sp|Q9M8Y4.1|ARR22_ARATH RecName: Full=Two-component response regulator ARR22 gi|6721158|gb|AAF26786.1|AC016829_10 putative response regulator protein (receiver component) [Arabidopsis thaliana] gi|21553766|gb|AAM62859.1| putative response regulator protein (receiver component) [Arabidopsis thaliana] gi|332640539|gb|AEE74060.1| two-component response regulator ARR22 [Arabidopsis thaliana] gi|332640540|gb|AEE74061.1| two-component response regulator ARR22 [Arabidopsis thaliana] gi|332640541|gb|AEE74062.1| two-component response regulator ARR22 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224105501|ref|XP_002313833.1| extra response regulator [Populus trichocarpa] gi|222850241|gb|EEE87788.1| extra response regulator [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255560269|ref|XP_002521152.1| sensory transduction histidine kinase bacterial, putative [Ricinus communis] gi|223539721|gb|EEF41303.1| sensory transduction histidine kinase bacterial, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356503660|ref|XP_003520624.1| PREDICTED: two-component response regulator ARR22-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356570702|ref|XP_003553524.1| PREDICTED: two-component response regulator ARR22-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30690228|ref|NP_850864.1| response regulator 24 [Arabidopsis thaliana] gi|332006174|gb|AED93557.1| response regulator 24 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 145 | ||||||
| TAIR|locus:2102960 | 142 | RR22 "response regulator 22" [ | 0.779 | 0.795 | 0.539 | 9.4e-27 | |
| TAIR|locus:1005716875 | 139 | RR24 "response regulator 24" [ | 0.786 | 0.820 | 0.473 | 7.6e-25 | |
| DICTYBASE|DDB_G0268012 | 382 | DDB_G0268012 "response regulat | 0.737 | 0.280 | 0.370 | 1.2e-13 | |
| UNIPROTKB|Q9KS16 | 572 | VC_1445 "Sensor histidine kina | 0.889 | 0.225 | 0.286 | 2.3e-13 | |
| TIGR_CMR|VC_1445 | 572 | VC_1445 "sensor histidine kina | 0.889 | 0.225 | 0.286 | 2.3e-13 | |
| TIGR_CMR|GSU_1671 | 322 | GSU_1671 "response regulator/G | 0.813 | 0.366 | 0.347 | 5.3e-13 | |
| DICTYBASE|DDB_G0291424 | 902 | DDB_G0291424 "Transcription fa | 0.737 | 0.118 | 0.345 | 7.5e-13 | |
| TIGR_CMR|CBU_0760 | 124 | CBU_0760 "response regulator p | 0.813 | 0.951 | 0.314 | 1.9e-12 | |
| TIGR_CMR|GSU_1285 | 772 | GSU_1285 "sensory box sensor h | 0.813 | 0.152 | 0.346 | 3.4e-12 | |
| UNIPROTKB|P14376 | 949 | rcsC "RcsC sensory histidine k | 0.793 | 0.121 | 0.318 | 5.7e-12 |
| TAIR|locus:2102960 RR22 "response regulator 22" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 301 (111.0 bits), Expect = 9.4e-27, P = 9.4e-27
Identities = 62/115 (53%), Positives = 81/115 (70%)
Query: 30 LVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTG-AKFHIVFIDMEMPVMDGIE 88
L+VDDDP+ RR+H MI+K++G + A+NG+EAV L R G A F ++ +D EMP DG+
Sbjct: 25 LIVDDDPLNRRLHEMIIKTIGGISQTAKNGEEAVILHRDGEASFDLILMDKEMPERDGVS 84
Query: 89 ATKAMRAMKVESKIVGVTS-RNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEEL 142
TK +R MKV S IVGVTS + E ER+ FM+AGL+ C KPLT AKI PL+ L
Sbjct: 85 TTKKLREMKVTSMIVGVTSVADQEEERKAFMEAGLNHCLEKPLTKAKIFPLISHL 139
|
|
| TAIR|locus:1005716875 RR24 "response regulator 24" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0268012 DDB_G0268012 "response regulator receiver domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KS16 VC_1445 "Sensor histidine kinase/response regulator" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1445 VC_1445 "sensor histidine kinase/response regulator" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1671 GSU_1671 "response regulator/GGDEF domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291424 DDB_G0291424 "Transcription factor SKN7" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0760 CBU_0760 "response regulator protein, putative" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1285 GSU_1285 "sensory box sensor histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P14376 rcsC "RcsC sensory histidine kinase" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 145 | |||
| cd00156 | 113 | cd00156, REC, Signal receiver domain; originally t | 2e-26 | |
| pfam00072 | 111 | pfam00072, Response_reg, Response regulator receiv | 1e-25 | |
| COG0784 | 130 | COG0784, CheY, FOG: CheY-like receiver [Signal tra | 2e-22 | |
| COG0745 | 229 | COG0745, OmpR, Response regulators consisting of a | 7e-18 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 1e-17 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 9e-15 | |
| PRK11107 | 919 | PRK11107, PRK11107, hybrid sensory histidine kinas | 2e-14 | |
| COG2197 | 211 | COG2197, CitB, Response regulator containing a Che | 4e-13 | |
| COG2204 | 464 | COG2204, AtoC, Response regulator containing CheY- | 9e-13 | |
| PRK11361 | 457 | PRK11361, PRK11361, acetoacetate metabolism regula | 2e-12 | |
| smart00448 | 55 | smart00448, REC, cheY-homologous receiver domain | 3e-12 | |
| PRK09959 | 1197 | PRK09959, PRK09959, hybrid sensory histidine kinas | 4e-12 | |
| COG3706 | 435 | COG3706, PleD, Response regulator containing a Che | 6e-11 | |
| PRK13557 | 540 | PRK13557, PRK13557, histidine kinase; Provisional | 1e-10 | |
| COG4753 | 475 | COG4753, COG4753, Response regulator containing Ch | 1e-10 | |
| PRK09468 | 239 | PRK09468, ompR, osmolarity response regulator; Pro | 2e-10 | |
| PRK10610 | 129 | PRK10610, PRK10610, chemotaxis regulatory protein | 3e-10 | |
| PRK10816 | 223 | PRK10816, PRK10816, DNA-binding transcriptional re | 1e-09 | |
| PRK00742 | 354 | PRK00742, PRK00742, chemotaxis-specific methyleste | 3e-09 | |
| PRK12555 | 337 | PRK12555, PRK12555, chemotaxis-specific methyleste | 1e-08 | |
| COG2201 | 350 | COG2201, CheB, Chemotaxis response regulator conta | 3e-08 | |
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 5e-08 | |
| CHL00148 | 240 | CHL00148, orf27, Ycf27; Reviewed | 6e-08 | |
| PRK10955 | 232 | PRK10955, PRK10955, DNA-binding transcriptional re | 6e-08 | |
| PRK11091 | 779 | PRK11091, PRK11091, aerobic respiration control se | 7e-08 | |
| PRK15115 | 444 | PRK15115, PRK15115, response regulator GlrR; Provi | 9e-08 | |
| TIGR02154 | 226 | TIGR02154, PhoB, phosphate regulon transcriptional | 1e-07 | |
| COG3437 | 360 | COG3437, COG3437, Response regulator containing a | 1e-07 | |
| PRK10365 | 441 | PRK10365, PRK10365, transcriptional regulatory pro | 2e-07 | |
| COG4565 | 224 | COG4565, CitB, Response regulator of citrate/malat | 2e-07 | |
| PRK11466 | 914 | PRK11466, PRK11466, hybrid sensory histidine kinas | 3e-07 | |
| PRK10766 | 221 | PRK10766, PRK10766, DNA-binding transcriptional re | 4e-07 | |
| PRK11083 | 228 | PRK11083, PRK11083, DNA-binding response regulator | 4e-07 | |
| PRK10403 | 215 | PRK10403, PRK10403, transcriptional regulator NarP | 1e-06 | |
| COG3279 | 244 | COG3279, LytT, Response regulator of the LytR/AlgR | 2e-06 | |
| PRK10651 | 216 | PRK10651, PRK10651, transcriptional regulator NarL | 3e-06 | |
| PRK09581 | 457 | PRK09581, pleD, response regulator PleD; Reviewed | 3e-06 | |
| TIGR01387 | 218 | TIGR01387, cztR_silR_copR, heavy metal response re | 4e-06 | |
| COG3947 | 361 | COG3947, COG3947, Response regulator containing Ch | 4e-06 | |
| PRK09390 | 202 | PRK09390, fixJ, response regulator FixJ; Provision | 1e-05 | |
| PRK10643 | 222 | PRK10643, PRK10643, DNA-binding transcriptional re | 1e-05 | |
| PRK09483 | 217 | PRK09483, PRK09483, response regulator; Provisiona | 2e-05 | |
| PRK15479 | 221 | PRK15479, PRK15479, transcriptional regulatory pro | 2e-05 | |
| COG4567 | 182 | COG4567, COG4567, Response regulator consisting of | 2e-05 | |
| PRK10336 | 219 | PRK10336, PRK10336, DNA-binding transcriptional re | 8e-05 | |
| PRK10161 | 229 | PRK10161, PRK10161, transcriptional regulator PhoB | 1e-04 | |
| COG4566 | 202 | COG4566, TtrR, Response regulator [Signal transduc | 1e-04 | |
| PRK11517 | 223 | PRK11517, PRK11517, transcriptional regulatory pro | 4e-04 | |
| PRK10529 | 225 | PRK10529, PRK10529, DNA-binding transcriptional ac | 0.001 | |
| TIGR01818 | 463 | TIGR01818, ntrC, nitrogen regulation protein NR(I) | 0.002 | |
| PRK09958 | 204 | PRK09958, PRK09958, DNA-binding transcriptional ac | 0.003 | |
| TIGR03787 | 227 | TIGR03787, marine_sort_RR, proteobacterial dedicat | 0.003 |
| >gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
Score = 95.7 bits (239), Expect = 2e-26
Identities = 35/113 (30%), Positives = 65/113 (57%), Gaps = 1/113 (0%)
Query: 30 LVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIEA 89
L+VDDDP+IR + +L+ G++V AE+G+EA+ L K ++ +D+ MP MDG+E
Sbjct: 1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEE-KPDLILLDIMMPGMDGLEL 59
Query: 90 TKAMRAMKVESKIVGVTSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEEL 142
+ +R + I+ +T+ + + ++AG D TKP + +++ + L
Sbjct: 60 LRRIRKRGPDIPIIFLTAHGDDEDAVEALKAGADDYLTKPFSPEELLARIRAL 112
|
Length = 113 |
| >gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|181883 PRK09468, ompR, osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182755 PRK10816, PRK10816, DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237135 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226931 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236838 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182431 PRK10403, PRK10403, transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225818 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182619 PRK10651, PRK10651, transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator | Back alignment and domain information |
|---|
| >gnl|CDD|226456 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236538 PRK09483, PRK09483, response regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226933 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|182387 PRK10336, PRK10336, DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182277 PRK10161, PRK10161, transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226932 COG4566, TtrR, Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182522 PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >gnl|CDD|182168 PRK09958, PRK09958, DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163499 TIGR03787, marine_sort_RR, proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 99.93 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 99.9 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 99.89 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.88 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 99.88 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 99.87 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 99.85 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 99.83 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 99.83 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 99.82 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 99.81 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 99.8 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 99.8 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 99.8 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 99.8 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 99.8 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 99.8 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 99.79 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 99.79 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 99.79 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 99.79 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 99.79 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 99.79 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 99.79 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 99.78 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 99.78 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 99.78 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 99.78 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 99.78 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 99.77 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 99.77 | |
| PRK09483 | 217 | response regulator; Provisional | 99.77 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 99.77 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 99.77 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 99.77 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 99.77 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 99.76 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 99.76 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 99.76 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 99.76 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 99.75 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 99.75 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 99.74 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 99.74 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 99.74 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.73 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 99.73 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 99.73 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.73 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 99.72 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 99.72 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 99.72 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 99.71 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.71 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 99.71 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 99.71 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 99.7 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 99.7 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 99.69 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.68 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 99.68 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 99.67 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 99.67 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 99.67 | |
| PRK13435 | 145 | response regulator; Provisional | 99.66 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.66 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 99.66 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 99.65 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 99.65 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 99.65 | |
| PRK00742 | 354 | chemotaxis-specific methylesterase; Provisional | 99.61 | |
| PRK13837 | 828 | two-component VirA-like sensor kinase; Provisional | 99.6 | |
| PRK13557 | 540 | histidine kinase; Provisional | 99.59 | |
| PRK09191 | 261 | two-component response regulator; Provisional | 99.56 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 99.55 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 99.55 | |
| COG2201 | 350 | CheB Chemotaxis response regulator containing a Ch | 99.49 | |
| PRK10693 | 303 | response regulator of RpoS; Provisional | 99.47 | |
| PRK15029 | 755 | arginine decarboxylase; Provisional | 99.39 | |
| COG3279 | 244 | LytT Response regulator of the LytR/AlgR family [T | 99.18 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 98.82 | |
| PF06490 | 109 | FleQ: Flagellar regulatory protein FleQ; InterPro: | 98.69 | |
| cd02071 | 122 | MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin | 98.38 | |
| PRK02261 | 137 | methylaspartate mutase subunit S; Provisional | 98.27 | |
| PF03709 | 115 | OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal | 98.27 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 98.27 | |
| TIGR00640 | 132 | acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal | 98.17 | |
| smart00448 | 55 | REC cheY-homologous receiver domain. CheY regulate | 98.15 | |
| TIGR01501 | 134 | MthylAspMutase methylaspartate mutase, S subunit. | 97.98 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 97.83 | |
| cd02072 | 128 | Glm_B12_BD B12 binding domain of glutamate mutase | 97.65 | |
| PRK15399 | 713 | lysine decarboxylase LdcC; Provisional | 97.35 | |
| COG2185 | 143 | Sbm Methylmalonyl-CoA mutase, C-terminal domain/su | 97.34 | |
| PF02310 | 121 | B12-binding: B12 binding domain; InterPro: IPR0061 | 97.28 | |
| PRK15400 | 714 | lysine decarboxylase CadA; Provisional | 97.23 | |
| COG4999 | 140 | Uncharacterized domain of BarA-like signal transdu | 97.19 | |
| cd02070 | 201 | corrinoid_protein_B12-BD B12 binding domain of cor | 97.12 | |
| cd02069 | 213 | methionine_synthase_B12_BD B12 binding domain of m | 97.06 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 97.06 | |
| PRK09426 | 714 | methylmalonyl-CoA mutase; Reviewed | 96.85 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 96.8 | |
| cd02068 | 127 | radical_SAM_B12_BD B12 binding domain_like associa | 96.55 | |
| TIGR02370 | 197 | pyl_corrinoid methyltransferase cognate corrinoid | 96.31 | |
| PRK05718 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 96.05 | |
| TIGR02026 | 497 | BchE magnesium-protoporphyrin IX monomethyl ester | 95.76 | |
| TIGR02311 | 249 | HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola | 95.74 | |
| PRK10558 | 256 | alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro | 95.41 | |
| PRK00043 | 212 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 95.27 | |
| PF01081 | 196 | Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 | 95.22 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 95.2 | |
| COG0512 | 191 | PabA Anthranilate/para-aminobenzoate synthases com | 95.05 | |
| PRK08385 | 278 | nicotinate-nucleotide pyrophosphorylase; Provision | 94.92 | |
| PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R | 94.71 | |
| TIGR01182 | 204 | eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho | 94.65 | |
| PRK10128 | 267 | 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional | 94.63 | |
| PRK07896 | 289 | nicotinate-nucleotide pyrophosphorylase; Provision | 94.6 | |
| cd02065 | 125 | B12-binding_like B12 binding domain (B12-BD). Most | 94.41 | |
| TIGR01334 | 277 | modD putative molybdenum utilization protein ModD. | 94.39 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 94.39 | |
| PF01729 | 169 | QRPTase_C: Quinolinate phosphoribosyl transferase, | 94.38 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 94.37 | |
| PRK07428 | 288 | nicotinate-nucleotide pyrophosphorylase; Provision | 94.28 | |
| COG0157 | 280 | NadC Nicotinate-nucleotide pyrophosphorylase [Coen | 94.04 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 93.91 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 93.9 | |
| PRK05749 | 425 | 3-deoxy-D-manno-octulosonic-acid transferase; Revi | 93.87 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 93.78 | |
| PRK05848 | 273 | nicotinate-nucleotide pyrophosphorylase; Provision | 93.73 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 93.73 | |
| PF10087 | 97 | DUF2325: Uncharacterized protein conserved in bact | 93.57 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 93.54 | |
| PF05690 | 247 | ThiG: Thiazole biosynthesis protein ThiG; InterPro | 93.51 | |
| PF07688 | 283 | KaiA: KaiA domain; InterPro: IPR011648 KaiA is a c | 93.47 | |
| TIGR03239 | 249 | GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co | 93.4 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 93.22 | |
| PRK15320 | 251 | transcriptional activator SprB; Provisional | 93.16 | |
| COG0800 | 211 | Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca | 93.11 | |
| TIGR02082 | 1178 | metH 5-methyltetrahydrofolate--homocysteine methyl | 92.66 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 92.64 | |
| PRK07114 | 222 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 92.64 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 92.59 | |
| PF13941 | 457 | MutL: MutL protein | 92.58 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 92.51 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 92.5 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 92.38 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 92.23 | |
| PRK06015 | 201 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 92.19 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.13 | |
| cd06533 | 171 | Glyco_transf_WecG_TagA The glycosyltransferase Wec | 92.09 | |
| PRK06559 | 290 | nicotinate-nucleotide pyrophosphorylase; Provision | 91.93 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 91.85 | |
| PF04131 | 192 | NanE: Putative N-acetylmannosamine-6-phosphate epi | 91.85 | |
| PF03328 | 221 | HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family | 91.84 | |
| PRK09490 | 1229 | metH B12-dependent methionine synthase; Provisiona | 91.64 | |
| cd04727 | 283 | pdxS PdxS is a subunit of the pyridoxal 5'-phospha | 91.49 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 91.44 | |
| PRK06774 | 191 | para-aminobenzoate synthase component II; Provisio | 91.4 | |
| TIGR00566 | 188 | trpG_papA glutamine amidotransferase of anthranila | 91.22 | |
| TIGR00693 | 196 | thiE thiamine-phosphate pyrophosphorylase. This mo | 91.2 | |
| PRK11359 | 799 | cyclic-di-GMP phosphodiesterase; Provisional | 91.1 | |
| PRK06543 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 91.07 | |
| PRK06096 | 284 | molybdenum transport protein ModD; Provisional | 91.06 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 90.82 | |
| PRK14329 | 467 | (dimethylallyl)adenosine tRNA methylthiotransferas | 90.79 | |
| PRK13566 | 720 | anthranilate synthase; Provisional | 90.78 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 90.74 | |
| TIGR01579 | 414 | MiaB-like-C MiaB-like tRNA modifying enzyme. This | 90.56 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 90.52 | |
| TIGR00642 | 619 | mmCoA_mut_beta methylmalonyl-CoA mutase, heterodim | 90.49 | |
| smart00052 | 241 | EAL Putative diguanylate phosphodiesterase. Putati | 90.45 | |
| PRK06978 | 294 | nicotinate-nucleotide pyrophosphorylase; Provision | 90.42 | |
| cd01573 | 272 | modD_like ModD; Quinolinate phosphoribosyl transfe | 90.22 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 90.11 | |
| TIGR00343 | 287 | pyridoxal 5'-phosphate synthase, synthase subunit | 90.05 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 90.02 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 90.01 | |
| PRK08007 | 187 | para-aminobenzoate synthase component II; Provisio | 90.0 | |
| CHL00162 | 267 | thiG thiamin biosynthesis protein G; Validated | 89.86 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 89.78 | |
| cd04724 | 242 | Tryptophan_synthase_alpha Ttryptophan synthase (TR | 89.76 | |
| PRK05637 | 208 | anthranilate synthase component II; Provisional | 89.69 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 89.61 | |
| PRK07649 | 195 | para-aminobenzoate/anthranilate synthase glutamine | 89.48 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 89.37 | |
| PRK05670 | 189 | anthranilate synthase component II; Provisional | 89.21 | |
| PLN02335 | 222 | anthranilate synthase | 89.16 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 89.15 | |
| PRK10060 | 663 | RNase II stability modulator; Provisional | 89.09 | |
| TIGR00736 | 231 | nifR3_rel_arch TIM-barrel protein, putative. Membe | 89.02 | |
| PRK03958 | 176 | tRNA 2'-O-methylase; Reviewed | 88.98 | |
| PF04131 | 192 | NanE: Putative N-acetylmannosamine-6-phosphate epi | 88.88 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 88.76 | |
| PRK09016 | 296 | quinolinate phosphoribosyltransferase; Validated | 88.35 | |
| PF01729 | 169 | QRPTase_C: Quinolinate phosphoribosyl transferase, | 88.34 | |
| PF03808 | 172 | Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp | 88.27 | |
| COG1908 | 132 | FrhD Coenzyme F420-reducing hydrogenase, delta sub | 88.15 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 88.09 | |
| cd01948 | 240 | EAL EAL domain. This domain is found in diverse ba | 87.92 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 87.86 | |
| PRK06895 | 190 | putative anthranilate synthase component II; Provi | 87.66 | |
| cd01568 | 269 | QPRTase_NadC Quinolinate phosphoribosyl transferas | 87.59 | |
| TIGR01319 | 463 | glmL_fam conserved hypothetical protein. This smal | 87.49 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 87.41 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 87.2 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 87.13 | |
| TIGR00696 | 177 | wecB_tagA_cpsF bacterial polymer biosynthesis prot | 87.06 | |
| PLN02591 | 250 | tryptophan synthase | 86.98 | |
| PLN02871 | 465 | UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | 86.91 | |
| PF14606 | 178 | Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase fami | 86.91 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 86.9 | |
| PRK14331 | 437 | (dimethylallyl)adenosine tRNA methylthiotransferas | 86.69 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 86.31 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 86.16 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 85.79 | |
| TIGR00089 | 429 | RNA modification enzyme, MiaB family. This subfami | 85.73 | |
| COG3010 | 229 | NanE Putative N-acetylmannosamine-6-phosphate epim | 85.68 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 85.44 | |
| PRK07455 | 187 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 85.32 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 84.97 | |
| PRK08072 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 84.97 | |
| COG0157 | 280 | NadC Nicotinate-nucleotide pyrophosphorylase [Coen | 84.95 | |
| COG3836 | 255 | HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola | 84.82 | |
| cd00564 | 196 | TMP_TenI Thiamine monophosphate synthase (TMP synt | 84.82 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 84.71 | |
| COG2200 | 256 | Rtn c-di-GMP phosphodiesterase class I (EAL domain | 84.14 | |
| TIGR03128 | 206 | RuMP_HxlA 3-hexulose-6-phosphate synthase. at the | 84.02 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 83.82 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 83.55 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 83.55 | |
| PRK08857 | 193 | para-aminobenzoate synthase component II; Provisio | 83.5 | |
| COG0621 | 437 | MiaB 2-methylthioadenine synthetase [Translation, | 83.44 | |
| PF02581 | 180 | TMP-TENI: Thiamine monophosphate synthase/TENI; In | 83.38 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 83.21 | |
| CHL00101 | 190 | trpG anthranilate synthase component 2 | 83.1 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 83.0 | |
| COG2109 | 198 | BtuR ATP:corrinoid adenosyltransferase [Coenzyme m | 82.92 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 82.72 | |
| COG2022 | 262 | ThiG Uncharacterized enzyme of thiazole biosynthes | 82.53 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 82.43 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 82.35 | |
| CHL00200 | 263 | trpA tryptophan synthase alpha subunit; Provisiona | 82.31 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 82.26 | |
| COG5012 | 227 | Predicted cobalamin binding protein [General funct | 81.89 | |
| PRK14333 | 448 | (dimethylallyl)adenosine tRNA methylthiotransferas | 81.89 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 81.88 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 81.81 | |
| PRK14098 | 489 | glycogen synthase; Provisional | 81.67 | |
| PF03060 | 330 | NMO: Nitronate monooxygenase; InterPro: IPR004136 | 81.2 | |
| PRK13125 | 244 | trpA tryptophan synthase subunit alpha; Provisiona | 81.17 | |
| COG0159 | 265 | TrpA Tryptophan synthase alpha chain [Amino acid t | 81.1 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 81.03 | |
| KOG4175 | 268 | consensus Tryptophan synthase alpha chain [Amino a | 80.87 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 80.68 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 80.62 | |
| TIGR01815 | 717 | TrpE-clade3 anthranilate synthase, alpha proteobac | 80.58 | |
| PF00218 | 254 | IGPS: Indole-3-glycerol phosphate synthase; InterP | 80.37 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 80.17 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 80.11 | |
| PF09456 | 92 | RcsC: RcsC Alpha-Beta-Loop (ABL); InterPro: IPR019 | 80.03 |
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
Probab=99.93 E-value=8.1e-25 Score=153.37 Aligned_cols=117 Identities=30% Similarity=0.520 Sum_probs=110.4
Q ss_pred cEEEEEeCCHHHHHHHHHHHHhcCCeEEEecCHHHHHHHHhcCCCccEEEEeCCCCCCCHHHHHHHHHhh-CCCCcEEEE
Q 045936 27 YFALVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIEATKAMRAM-KVESKIVGV 105 (145)
Q Consensus 27 ~~vlii~~~~~~~~~l~~~l~~~g~~v~~~~~~~~~l~~l~~~~~~dlil~d~~~~~~~g~~~~~~l~~~-~~~~~ii~l 105 (145)
++||++||++.....+...|+..||.+..+.++++++..+.. . ||+||+|+++|+++|+++++.+|+. ....|||++
T Consensus 1 ~~ILiveDd~~i~~~l~~~L~~~g~~v~~~~~~~~a~~~~~~-~-~dlviLD~~lP~~dG~~~~~~iR~~~~~~~PIi~L 78 (229)
T COG0745 1 MRILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAARE-Q-PDLVLLDLMLPDLDGLELCRRLRAKKGSGPPIIVL 78 (229)
T ss_pred CeEEEEcCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHhc-C-CCEEEEECCCCCCCHHHHHHHHHhhcCCCCcEEEE
Confidence 479999999999999999999999999999999999999987 6 9999999999999999999999964 567889999
Q ss_pred ecCCChHHHHHHHHhcccEEeeCCCCHHHHHHHHHHHhhC
Q 045936 106 TSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEELQKN 145 (145)
Q Consensus 106 t~~~~~~~~~~~~~~g~~~~l~kP~~~~~l~~~l~~~~~~ 145 (145)
|+..+......+++.|||+|++|||++.+|.++++.++++
T Consensus 79 ta~~~~~d~v~gl~~GADDYl~KPf~~~EL~ARi~a~lRR 118 (229)
T COG0745 79 TARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRALLRR 118 (229)
T ss_pred ECCCcHHHHHHHHhCcCCeeeeCCCCHHHHHHHHHHHHCc
Confidence 9999999999999999999999999999999999998863
|
|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK00742 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK13837 two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09191 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10693 response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >PRK15029 arginine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e | Back alignment and domain information |
|---|
| >cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain | Back alignment and domain information |
|---|
| >PRK02261 methylaspartate mutase subunit S; Provisional | Back alignment and domain information |
|---|
| >PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain | Back alignment and domain information |
|---|
| >smart00448 REC cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >TIGR01501 MthylAspMutase methylaspartate mutase, S subunit | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) | Back alignment and domain information |
|---|
| >PRK15399 lysine decarboxylase LdcC; Provisional | Back alignment and domain information |
|---|
| >COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) | Back alignment and domain information |
|---|
| >PRK15400 lysine decarboxylase CadA; Provisional | Back alignment and domain information |
|---|
| >COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins | Back alignment and domain information |
|---|
| >cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PRK09426 methylmalonyl-CoA mutase; Reviewed | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain | Back alignment and domain information |
|---|
| >TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family | Back alignment and domain information |
|---|
| >PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase | Back alignment and domain information |
|---|
| >TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase | Back alignment and domain information |
|---|
| >PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01182 eda Entner-Doudoroff aldolase | Back alignment and domain information |
|---|
| >PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd02065 B12-binding_like B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >TIGR01334 modD putative molybdenum utilization protein ModD | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences | Back alignment and domain information |
|---|
| >PF07688 KaiA: KaiA domain; InterPro: IPR011648 KaiA is a component of the kaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria | Back alignment and domain information |
|---|
| >TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK15320 transcriptional activator SprB; Provisional | Back alignment and domain information |
|---|
| >COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13941 MutL: MutL protein | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins | Back alignment and domain information |
|---|
| >PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: |
Back alignment and domain information |
|---|
| >PF03328 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family; InterPro: IPR005000 This family includes 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (4 | Back alignment and domain information |
|---|
| >PRK09490 metH B12-dependent methionine synthase; Provisional | Back alignment and domain information |
|---|
| >cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >PRK06774 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase | Back alignment and domain information |
|---|
| >TIGR00693 thiE thiamine-phosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK11359 cyclic-di-GMP phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06096 molybdenum transport protein ModD; Provisional | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13566 anthranilate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >TIGR00642 mmCoA_mut_beta methylmalonyl-CoA mutase, heterodimeric type, beta chain | Back alignment and domain information |
|---|
| >smart00052 EAL Putative diguanylate phosphodiesterase | Back alignment and domain information |
|---|
| >PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >PRK08007 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >CHL00162 thiG thiamin biosynthesis protein G; Validated | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) | Back alignment and domain information |
|---|
| >PRK05637 anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05670 anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PLN02335 anthranilate synthase | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK10060 RNase II stability modulator; Provisional | Back alignment and domain information |
|---|
| >TIGR00736 nifR3_rel_arch TIM-barrel protein, putative | Back alignment and domain information |
|---|
| >PRK03958 tRNA 2'-O-methylase; Reviewed | Back alignment and domain information |
|---|
| >PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: |
Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >PRK09016 quinolinate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli | Back alignment and domain information |
|---|
| >COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd01948 EAL EAL domain | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK06895 putative anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >TIGR01319 glmL_fam conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family | Back alignment and domain information |
|---|
| >PLN02591 tryptophan synthase | Back alignment and domain information |
|---|
| >PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | Back alignment and domain information |
|---|
| >PF14606 Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase family; PDB: 3SKV_B | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00089 RNA modification enzyme, MiaB family | Back alignment and domain information |
|---|
| >COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3836 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >COG2200 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08857 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >CHL00101 trpG anthranilate synthase component 2 | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >CHL00200 trpA tryptophan synthase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >COG5012 Predicted cobalamin binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14098 glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 | Back alignment and domain information |
|---|
| >PRK13125 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade | Back alignment and domain information |
|---|
| >PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF09456 RcsC: RcsC Alpha-Beta-Loop (ABL); InterPro: IPR019017 This domain is found in the C terminus of the signal transduction response regulator (phospho-relay) kinase RcsC, between the ATP-binding region (IPR003594 from INTERPRO) and the receiver region (IPR001789 from INTERPRO) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 145 | ||||
| 2ayx_A | 254 | Solution Structure Of The E.Coli Rcsc C-Terminus (R | 1e-14 | ||
| 2ayz_A | 133 | Solution Structure Of The E.Coli Rcsc C-Terminus (R | 2e-14 | ||
| 3a0u_A | 116 | Crystal Structure Of Response Regulator Protein Trr | 1e-09 | ||
| 3fft_A | 128 | Crystal Structure Of Chey Double Mutant F14e, E89r | 1e-09 | ||
| 3fgz_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 3e-09 | ||
| 1ab5_A | 125 | Structure Of Chey Mutant F14n, V21t Length = 125 | 3e-09 | ||
| 3rvl_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 3e-09 | ||
| 1ab6_A | 125 | Structure Of Chey Mutant F14n, V86t Length = 125 | 4e-09 | ||
| 3a0r_B | 116 | Crystal Structure Of Histidine Kinase Thka (Tm1359) | 6e-09 | ||
| 1udr_A | 129 | Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Rep | 6e-09 | ||
| 3ffx_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59r, | 7e-09 | ||
| 2chy_A | 128 | Three-Dimensional Structure Of Chey, The Response R | 9e-09 | ||
| 3rvp_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 9e-09 | ||
| 3mm4_A | 206 | Crystal Structure Of The Receiver Domain Of The His | 1e-08 | ||
| 3ffw_A | 128 | Crystal Structure Of Chey Triple Mutant F14q, N59k, | 1e-08 | ||
| 1jbe_A | 128 | 1.08 A Structure Of Apo-Chey Reveals Meta-Active Co | 1e-08 | ||
| 3rvj_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 1e-08 | ||
| 3olx_A | 129 | Structural And Functional Effects Of Substitution A | 1e-08 | ||
| 2che_A | 128 | Structure Of The Mg2+-Bound Form Of Chey And Mechan | 1e-08 | ||
| 2fka_A | 129 | Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Che | 1e-08 | ||
| 3r0j_A | 250 | Structure Of Phop From Mycobacterium Tuberculosis L | 1e-08 | ||
| 5chy_A | 128 | Structure Of Chemotaxis Protein Chey Length = 128 | 2e-08 | ||
| 3rvn_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 2e-08 | ||
| 1d4z_A | 128 | Crystal Structure Of Chey-95iv, A Hyperactive Chey | 2e-08 | ||
| 3f7n_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 3e-08 | ||
| 1cye_A | 129 | Three Dimensional Structure Of Chemotactic Che Y Pr | 3e-08 | ||
| 1eay_A | 128 | Chey-Binding (P2) Domain Of Chea In Complex With Ch | 3e-08 | ||
| 3olw_A | 129 | Structural And Functional Effects Of Substitution A | 3e-08 | ||
| 1cey_A | 128 | Assignments, Secondary Structure, Global Fold, And | 3e-08 | ||
| 1djm_A | 129 | Solution Structure Of Bef3-Activated Chey From Esch | 3e-08 | ||
| 1mih_A | 129 | A Role For Chey Glu 89 In Chez-Mediated Dephosphory | 3e-08 | ||
| 1ymv_A | 129 | Signal Transduction Protein Chey Mutant With Phe 14 | 4e-08 | ||
| 3myy_A | 128 | Structure Of E. Coli Chey Mutant A113p Bound To Ber | 5e-08 | ||
| 6chy_A | 128 | Structure Of Chemotaxis Protein Chey Length = 128 | 5e-08 | ||
| 3oo0_A | 129 | Structure Of Apo Chey A113p Length = 129 | 5e-08 | ||
| 3f6p_A | 120 | Crystal Structure Of Unphosphorelated Receiver Doma | 6e-08 | ||
| 2zwm_A | 130 | Crystal Structure Of Yycf Receiver Domain From Baci | 6e-08 | ||
| 1ys6_A | 233 | Crystal Structure Of The Response Regulatory Protei | 8e-08 | ||
| 1vlz_A | 128 | Uncoupled Phosphorylation And Activation In Bacteri | 8e-08 | ||
| 1ymu_A | 130 | Signal Transduction Protein Chey Mutant With Met 17 | 8e-08 | ||
| 3olv_A | 129 | Structural And Functional Effects Of Substitution A | 8e-08 | ||
| 3oly_A | 129 | Structural And Functional Effects Of Substitution A | 9e-08 | ||
| 1mvo_A | 136 | Crystal Structure Of The Phop Receiver Domain From | 1e-07 | ||
| 1ehc_A | 128 | Structure Of Signal Transduction Protein Chey Lengt | 2e-07 | ||
| 1zdm_A | 129 | Crystal Structure Of Activated Chey Bound To Xe Len | 2e-07 | ||
| 1c4w_A | 128 | 1.9 A Structure Of A-Thiophosphonate Modified Chey | 2e-07 | ||
| 1e6k_A | 130 | Two-Component Signal Transduction System D12a Mutan | 2e-07 | ||
| 1e6m_A | 128 | Two-Component Signal Transduction System D57a Mutan | 3e-07 | ||
| 1e6l_A | 127 | Two-Component Signal Transduction System D13a Mutan | 3e-07 | ||
| 1oxb_B | 134 | Complex Between Ypd1 And Sln1 Response Regulator Do | 3e-07 | ||
| 2r25_B | 133 | Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef | 3e-07 | ||
| 3to5_A | 134 | High Resolution Structure Of Chey3 From Vibrio Chol | 3e-07 | ||
| 2oqr_A | 230 | The Structure Of The Response Regulator Regx3 From | 4e-07 | ||
| 3kyj_B | 145 | Crystal Structure Of The P1 Domain Of Chea3 In Comp | 4e-07 | ||
| 2id9_A | 128 | 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length | 4e-07 | ||
| 2pkx_A | 121 | E.Coli Response Regulator Phop Receiver Domain Leng | 4e-07 | ||
| 1nxo_A | 120 | Micarec Ph7.0 Length = 120 | 5e-07 | ||
| 2id7_A | 128 | 1.75 A Structure Of T87i Phosphono-Chey Length = 12 | 7e-07 | ||
| 1u8t_A | 128 | Crystal Structure Of Chey D13k Y106w Alone And In C | 1e-06 | ||
| 3kyi_B | 145 | Crystal Structure Of The Phosphorylated P1 Domain O | 2e-06 | ||
| 3cg4_A | 142 | Crystal Structure Of Response Regulator Receiver Do | 2e-06 | ||
| 3gwg_A | 129 | Crystal Structure Of Chey Of Helicobacter Pylori Le | 2e-06 | ||
| 3h1g_A | 129 | Crystal Structure Of Chey Mutant T84a Of Helicobact | 2e-06 | ||
| 3c97_A | 140 | Crystal Structure Of The Response Regulator Receive | 3e-06 | ||
| 4euk_A | 153 | Crystal Structure Length = 153 | 3e-06 | ||
| 1nxt_A | 120 | Micarec Ph 4.0 Length = 120 | 4e-06 | ||
| 4e7o_A | 150 | Crystal Structure Of Receiver Domain Of Putative Na | 4e-06 | ||
| 3dge_C | 122 | Structure Of A Histidine Kinase-response Regulator | 8e-06 | ||
| 3tmy_A | 120 | Chey From Thermotoga Maritima (Mn-Iii) Length = 120 | 9e-06 | ||
| 1zgz_A | 122 | Crystal Structure Of The Receiver Domain Of Tmao Re | 9e-06 | ||
| 1srr_A | 124 | Crystal Structure Of A Phosphatase Resistant Mutant | 2e-05 | ||
| 1f51_E | 119 | A Transient Interaction Between Two Phosphorelay Pr | 2e-05 | ||
| 2jvi_A | 132 | Nmr Solution Structure Of The Hyper-Sporulation Res | 2e-05 | ||
| 3nhz_A | 125 | Structure Of N-Terminal Domain Of Mtra Length = 125 | 2e-05 | ||
| 2jvk_A | 132 | Nmr Solution Structure Of The Hyper-Sporulation Res | 2e-05 | ||
| 3h1f_A | 129 | Crystal Structure Of Chey Mutant D53a Of Helicobact | 2e-05 | ||
| 2jba_A | 127 | Phob Response Regulator Receiver Domain Constitutiv | 2e-05 | ||
| 2jvj_A | 132 | Nmr Solution Structure Of The Hyper-Sporulation Res | 2e-05 | ||
| 3q15_C | 126 | Crystal Structure Of Raph Complexed With Spo0f Leng | 2e-05 | ||
| 1u0s_Y | 118 | Chemotaxis Kinase Chea P2 Domain In Complex With Re | 3e-05 | ||
| 1pux_A | 124 | Nmr Solution Structure Of Bef3-Activated Spo0f, 20 | 3e-05 | ||
| 1zy2_A | 150 | Crystal Structure Of The Phosphorylated Receiver Do | 3e-05 | ||
| 3i42_A | 127 | Structure Of Response Regulator Receiver Domain (Ch | 3e-05 | ||
| 3gl9_A | 122 | The Structure Of A Histidine Kinase-Response Regula | 3e-05 | ||
| 1s8n_A | 205 | Crystal Structure Of Rv1626 From Mycobacterium Tube | 3e-05 | ||
| 1hey_A | 128 | Investigating The Structural Determinants Of The P2 | 4e-05 | ||
| 2jba_B | 127 | Phob Response Regulator Receiver Domain Constitutiv | 6e-05 | ||
| 3f7a_A | 394 | Structure Of Orthorhombic Crystal Form Of Pseudomon | 6e-05 | ||
| 3eq2_A | 394 | Structure Of Hexagonal Crystal Form Of Pseudomonas | 6e-05 | ||
| 3nnn_A | 122 | Bef3 Activated Drrd Receiver Domain Length = 122 | 1e-04 | ||
| 3lte_A | 132 | Crystal Structure Of Response Regulator (Signal Rec | 1e-04 | ||
| 1zh2_A | 121 | Crystal Structure Of The Calcium-Bound Receiver Dom | 1e-04 | ||
| 2ftk_E | 124 | Berylloflouride Spo0f Complex With Spo0b Length = 1 | 1e-04 | ||
| 1b00_A | 127 | Phob Receiver Domain From Escherichia Coli Length = | 2e-04 | ||
| 1zes_A | 125 | Bef3- Activated Phob Receiver Domain Length = 125 | 2e-04 | ||
| 1kgs_A | 225 | Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG | 3e-04 | ||
| 3m6m_D | 143 | Crystal Structure Of Rpff Complexed With Rec Domain | 3e-04 | ||
| 3hzh_A | 157 | Crystal Structure Of The Chex-Chey-Bef3-Mg+2 Comple | 4e-04 | ||
| 1p6u_A | 129 | Nmr Structure Of The Bef3-Activated Structure Of Th | 9e-04 |
| >pdb|2AYX|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 700-949) Containing Linker Region And Phosphoreceiver Domain Length = 254 | Back alignment and structure |
|
| >pdb|2AYZ|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 817-949) Containing Phosphoreceiver Domain Length = 133 | Back alignment and structure |
| >pdb|3A0U|A Chain A, Crystal Structure Of Response Regulator Protein Trra (Tm1360) From Thermotoga Maritima In Complex With Mg(2+)- Bef (Wild Type) Length = 116 | Back alignment and structure |
| >pdb|3FFT|A Chain A, Crystal Structure Of Chey Double Mutant F14e, E89r Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|3FGZ|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89r Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1AB5|A Chain A, Structure Of Chey Mutant F14n, V21t Length = 125 | Back alignment and structure |
| >pdb|3RVL|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89r Length = 132 | Back alignment and structure |
| >pdb|1AB6|A Chain A, Structure Of Chey Mutant F14n, V86t Length = 125 | Back alignment and structure |
| >pdb|3A0R|B Chain B, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 116 | Back alignment and structure |
| >pdb|1UDR|A Chain A, Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Replaced By Ala, Ile 96 Replaced By Lys And Ala 98 Replaced By Leu (Stabilizing Mutations In Helix 4) Length = 129 | Back alignment and structure |
| >pdb|3FFX|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59r, E89h Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|2CHY|A Chain A, Three-Dimensional Structure Of Chey, The Response Regulator Of Bacterial Chemotaxis Length = 128 | Back alignment and structure |
| >pdb|3RVP|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89k Length = 132 | Back alignment and structure |
| >pdb|3MM4|A Chain A, Crystal Structure Of The Receiver Domain Of The Histidine Kinase Cki1 From Arabidopsis Thaliana Length = 206 | Back alignment and structure |
| >pdb|3FFW|A Chain A, Crystal Structure Of Chey Triple Mutant F14q, N59k, E89y Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1JBE|A Chain A, 1.08 A Structure Of Apo-Chey Reveals Meta-Active Conformation Length = 128 | Back alignment and structure |
| >pdb|3RVJ|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89q Length = 132 | Back alignment and structure |
| >pdb|3OLX|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88s-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|2CHE|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And Mechanism Of Phosphoryl Transfer In Bacterial Chemotaxis Length = 128 | Back alignment and structure |
| >pdb|2FKA|A Chain A, Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Chey In Complex With Chez(200-214) Solved From A F432 Crystal Grown In Caps (Ph 10.5) Length = 129 | Back alignment and structure |
| >pdb|3R0J|A Chain A, Structure Of Phop From Mycobacterium Tuberculosis Length = 250 | Back alignment and structure |
| >pdb|5CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 | Back alignment and structure |
| >pdb|3RVN|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89y Length = 132 | Back alignment and structure |
| >pdb|1D4Z|A Chain A, Crystal Structure Of Chey-95iv, A Hyperactive Chey Mutant Length = 128 | Back alignment and structure |
| >pdb|3F7N|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89l Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1CYE|A Chain A, Three Dimensional Structure Of Chemotactic Che Y Protein In Aqueous Solution By Nuclear Magnetic Resonance Methods Length = 129 | Back alignment and structure |
| >pdb|1EAY|A Chain A, Chey-Binding (P2) Domain Of Chea In Complex With Chey From Escherichia Coli Length = 128 | Back alignment and structure |
| >pdb|3OLW|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88t-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|1CEY|A Chain A, Assignments, Secondary Structure, Global Fold, And Dynamics Of Chemotaxis Y Protein Using Three-And Four-Dimensional Heteronuclear (13c,15n) Nmr Spectroscopy Length = 128 | Back alignment and structure |
| >pdb|1DJM|A Chain A, Solution Structure Of Bef3-Activated Chey From Escherichia Coli Length = 129 | Back alignment and structure |
| >pdb|1MIH|A Chain A, A Role For Chey Glu 89 In Chez-Mediated Dephosphorylation Of The E. Coli Chemotaxis Response Regulator Chey Length = 129 | Back alignment and structure |
| >pdb|1YMV|A Chain A, Signal Transduction Protein Chey Mutant With Phe 14 Replaced By Gly, Ser 15 Replaced By Gly, And Met 17 Replaced By Gly Length = 129 | Back alignment and structure |
| >pdb|3MYY|A Chain A, Structure Of E. Coli Chey Mutant A113p Bound To Beryllium Fluoride Length = 128 | Back alignment and structure |
| >pdb|6CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 | Back alignment and structure |
| >pdb|3OO0|A Chain A, Structure Of Apo Chey A113p Length = 129 | Back alignment and structure |
| >pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120 | Back alignment and structure |
| >pdb|2ZWM|A Chain A, Crystal Structure Of Yycf Receiver Domain From Bacillus Subtilis Length = 130 | Back alignment and structure |
| >pdb|1YS6|A Chain A, Crystal Structure Of The Response Regulatory Protein Prra From Mycobacterium Tuberculosis Length = 233 | Back alignment and structure |
| >pdb|1VLZ|A Chain A, Uncoupled Phosphorylation And Activation In Bacterial Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To Isoleucine Mutant At Position 87 Of Chey Length = 128 | Back alignment and structure |
| >pdb|1YMU|A Chain A, Signal Transduction Protein Chey Mutant With Met 17 Replaced By Gly (M17g) Length = 130 | Back alignment and structure |
| >pdb|3OLV|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88v-Bef3-Mg Complex Length = 129 | Back alignment and structure |
| >pdb|3OLY|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88m-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From Bacillus Subtilis Length = 136 | Back alignment and structure |
| >pdb|1EHC|A Chain A, Structure Of Signal Transduction Protein Chey Length = 128 | Back alignment and structure |
| >pdb|1ZDM|A Chain A, Crystal Structure Of Activated Chey Bound To Xe Length = 129 | Back alignment and structure |
| >pdb|1C4W|A Chain A, 1.9 A Structure Of A-Thiophosphonate Modified Chey D57c Length = 128 | Back alignment and structure |
| >pdb|1E6K|A Chain A, Two-Component Signal Transduction System D12a Mutant Of Chey Length = 130 | Back alignment and structure |
| >pdb|1E6M|A Chain A, Two-Component Signal Transduction System D57a Mutant Of Chey Length = 128 | Back alignment and structure |
| >pdb|1E6L|A Chain A, Two-Component Signal Transduction System D13a Mutant Of Chey Length = 127 | Back alignment and structure |
| >pdb|1OXB|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain In Space Group P2(1)2(1)2(1) Length = 134 | Back alignment and structure |
| >pdb|2R25|B Chain B, Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef3- Length = 133 | Back alignment and structure |
| >pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 | Back alignment and structure |
| >pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 | Back alignment and structure |
| >pdb|3KYJ|B Chain B, Crystal Structure Of The P1 Domain Of Chea3 In Complex With Chey6 From R. Sphaeroides Length = 145 | Back alignment and structure |
| >pdb|2ID9|A Chain A, 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length = 128 | Back alignment and structure |
| >pdb|2PKX|A Chain A, E.Coli Response Regulator Phop Receiver Domain Length = 121 | Back alignment and structure |
| >pdb|1NXO|A Chain A, Micarec Ph7.0 Length = 120 | Back alignment and structure |
| >pdb|2ID7|A Chain A, 1.75 A Structure Of T87i Phosphono-Chey Length = 128 | Back alignment and structure |
| >pdb|1U8T|A Chain A, Crystal Structure Of Chey D13k Y106w Alone And In Complex With A Flim Peptide Length = 128 | Back alignment and structure |
| >pdb|3KYI|B Chain B, Crystal Structure Of The Phosphorylated P1 Domain Of Chea3 In Complex With Chey6 From R. Sphaeroides Length = 145 | Back alignment and structure |
| >pdb|3CG4|A Chain A, Crystal Structure Of Response Regulator Receiver Domain Protein (Chey- Like) From Methanospirillum Hungatei Jf-1 Length = 142 | Back alignment and structure |
| >pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 | Back alignment and structure |
| >pdb|4EUK|A Chain A, Crystal Structure Length = 153 | Back alignment and structure |
| >pdb|1NXT|A Chain A, Micarec Ph 4.0 Length = 120 | Back alignment and structure |
| >pdb|4E7O|A Chain A, Crystal Structure Of Receiver Domain Of Putative Narl Family Response Regulator Spr1814 From Streptococcus Pneumoniae Length = 150 | Back alignment and structure |
| >pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 | Back alignment and structure |
| >pdb|3TMY|A Chain A, Chey From Thermotoga Maritima (Mn-Iii) Length = 120 | Back alignment and structure |
| >pdb|1ZGZ|A Chain A, Crystal Structure Of The Receiver Domain Of Tmao Respiratory System Response Regulator Torr Length = 122 | Back alignment and structure |
| >pdb|1SRR|A Chain A, Crystal Structure Of A Phosphatase Resistant Mutant Of Sporulation Response Regulator Spo0f From Bacillus Subtilis Length = 124 | Back alignment and structure |
| >pdb|1F51|E Chain E, A Transient Interaction Between Two Phosphorelay Proteins Trapped In A Crystal Lattice Reveals The Mechanism Of Molecular Recognition And Phosphotransfer In Singal Transduction Length = 119 | Back alignment and structure |
| >pdb|2JVI|A Chain A, Nmr Solution Structure Of The Hyper-Sporulation Response Regulator Spo0f Mutant H101a From Bacillus Subtilis Length = 132 | Back alignment and structure |
| >pdb|3NHZ|A Chain A, Structure Of N-Terminal Domain Of Mtra Length = 125 | Back alignment and structure |
| >pdb|2JVK|A Chain A, Nmr Solution Structure Of The Hyper-Sporulation Response Regulator Spo0f Mutant L66a From Bacillus Subtilis Length = 132 | Back alignment and structure |
| >pdb|3H1F|A Chain A, Crystal Structure Of Chey Mutant D53a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|2JBA|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 | Back alignment and structure |
| >pdb|2JVJ|A Chain A, Nmr Solution Structure Of The Hyper-Sporulation Response Regulator Spo0f Mutant I90a From Bacillus Subtilis Length = 132 | Back alignment and structure |
| >pdb|3Q15|C Chain C, Crystal Structure Of Raph Complexed With Spo0f Length = 126 | Back alignment and structure |
| >pdb|1U0S|Y Chain Y, Chemotaxis Kinase Chea P2 Domain In Complex With Response Regulator Chey From The Thermophile Thermotoga Maritima Length = 118 | Back alignment and structure |
| >pdb|1PUX|A Chain A, Nmr Solution Structure Of Bef3-Activated Spo0f, 20 Conformers Length = 124 | Back alignment and structure |
| >pdb|1ZY2|A Chain A, Crystal Structure Of The Phosphorylated Receiver Domain Of The Transcription Regulator Ntrc1 From Aquifex Aeolicus Length = 150 | Back alignment and structure |
| >pdb|3I42|A Chain A, Structure Of Response Regulator Receiver Domain (Chey-Like) From Methylobacillus Flagellatus Length = 127 | Back alignment and structure |
| >pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 | Back alignment and structure |
| >pdb|1S8N|A Chain A, Crystal Structure Of Rv1626 From Mycobacterium Tuberculosis Length = 205 | Back alignment and structure |
| >pdb|1HEY|A Chain A, Investigating The Structural Determinants Of The P21-Like Triphosphate And Mg2+ Binding Site Length = 128 | Back alignment and structure |
| >pdb|2JBA|B Chain B, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 | Back alignment and structure |
| >pdb|3F7A|A Chain A, Structure Of Orthorhombic Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 | Back alignment and structure |
| >pdb|3EQ2|A Chain A, Structure Of Hexagonal Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 | Back alignment and structure |
| >pdb|3NNN|A Chain A, Bef3 Activated Drrd Receiver Domain Length = 122 | Back alignment and structure |
| >pdb|3LTE|A Chain A, Crystal Structure Of Response Regulator (Signal Receiver Domain) From Bermanella Marisrubri Length = 132 | Back alignment and structure |
| >pdb|1ZH2|A Chain A, Crystal Structure Of The Calcium-Bound Receiver Domain Of Kdp Potassium Transport System Response Regulator Kdpe Length = 121 | Back alignment and structure |
| >pdb|2FTK|E Chain E, Berylloflouride Spo0f Complex With Spo0b Length = 124 | Back alignment and structure |
| >pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli Length = 127 | Back alignment and structure |
| >pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain Length = 125 | Back alignment and structure |
| >pdb|1KGS|A Chain A, Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG FROM THERMOTOGA Maritima Length = 225 | Back alignment and structure |
| >pdb|3M6M|D Chain D, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 143 | Back alignment and structure |
| >pdb|3HZH|A Chain A, Crystal Structure Of The Chex-Chey-Bef3-Mg+2 Complex From Borrelia Burgdorferi Length = 157 | Back alignment and structure |
| >pdb|1P6U|A Chain A, Nmr Structure Of The Bef3-Activated Structure Of The Response Regulator Chey2-Mg2+ From Sinorhizobium Meliloti Length = 129 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 145 | |||
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 2e-29 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 2e-28 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 2e-19 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 2e-27 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 6e-27 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 8e-26 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 4e-24 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 6e-23 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 9e-23 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 1e-22 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 3e-22 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 3e-22 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 9e-22 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 4e-21 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 1e-20 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 1e-20 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 2e-20 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 3e-20 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 4e-20 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 1e-11 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 1e-19 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 3e-19 | |
| 3r0j_A | 250 | Possible two component system response transcript | 7e-19 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 3e-18 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 4e-18 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 4e-18 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 5e-18 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 2e-17 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 3e-17 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 4e-17 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 4e-17 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 4e-17 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 4e-17 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 5e-17 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 5e-17 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 5e-17 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 6e-17 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 7e-17 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 8e-17 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 8e-17 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 1e-16 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 1e-16 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 1e-16 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 2e-16 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 2e-16 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 2e-16 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 2e-16 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 2e-16 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 3e-16 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 3e-16 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 4e-16 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 7e-16 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 9e-16 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 1e-15 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 1e-15 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 2e-15 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 2e-15 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 2e-15 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 2e-15 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 3e-15 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 4e-15 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 7e-15 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 8e-15 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 9e-15 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 1e-14 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 1e-14 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 1e-14 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 1e-14 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 1e-14 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 1e-14 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 1e-14 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 2e-14 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 2e-14 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 2e-14 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 3e-14 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 6e-14 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 1e-13 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 1e-13 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 2e-13 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 2e-13 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 3e-13 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 3e-13 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 5e-13 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 5e-13 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 5e-13 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 6e-13 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 6e-13 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 7e-13 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 7e-13 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 1e-12 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 3e-12 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 3e-12 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 3e-12 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 4e-12 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 6e-12 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 7e-12 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 1e-11 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 1e-11 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 2e-11 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 2e-11 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 1e-10 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 9e-10 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 2e-09 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 3e-09 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 1e-08 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 7e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 |
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 | Back alignment and structure |
|---|
Score = 106 bits (266), Expect = 2e-29
Identities = 40/136 (29%), Positives = 72/136 (52%), Gaps = 1/136 (0%)
Query: 5 AEGASSSKKARISENPVSKNRPYFALVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVD 64
E + ++ VS N LVVDD P+ RR+ + L S+G++ + A +G +A++
Sbjct: 108 MESDDPANALPSTDKAVSDNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALN 167
Query: 65 LFRTGAKFHIVFIDMEMPVMDGIEATKAMRAMKVESKIVGVTSRNSETEREVFMQAGLDL 124
+ IV D+ MP MDG T+ +R + + ++GVT+ E++ +++G+D
Sbjct: 168 VLSKNH-IDIVLSDVNMPNMDGYRLTQRIRQLGLTLPVIGVTANALAEEKQRCLESGMDS 226
Query: 125 CYTKPLTMAKIVPLLE 140
C +KP+T+ I L
Sbjct: 227 CLSKPVTLDVIKQTLT 242
|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Length = 225 | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 99.97 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 99.94 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 99.93 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 99.93 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 99.93 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 99.93 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 99.93 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 99.93 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 99.92 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 99.92 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 99.92 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 99.92 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 99.92 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 99.92 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 99.92 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 99.92 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 99.92 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 99.92 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 99.92 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 99.92 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 99.92 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 99.92 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 99.91 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 99.91 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 99.91 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 99.91 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 99.91 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 99.91 | |
| 3r0j_A | 250 | Possible two component system response transcript | 99.91 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 99.91 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 99.91 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 99.91 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 99.91 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 99.91 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 99.91 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 99.91 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 99.91 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 99.91 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 99.91 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 99.91 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 99.9 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 99.9 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 99.9 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 99.9 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 99.9 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 99.9 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 99.9 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 99.9 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 99.9 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 99.9 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 99.9 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 99.9 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 99.9 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 99.9 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 99.9 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.9 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 99.9 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 99.9 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 99.9 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 99.9 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 99.9 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 99.9 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 99.9 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 99.9 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 99.9 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 99.89 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 99.89 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 99.89 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 99.89 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 99.89 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 99.89 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 99.89 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.89 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 99.89 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 99.89 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 99.88 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 99.88 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 99.88 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 99.88 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 99.88 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 99.88 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 99.88 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 99.88 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 99.88 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.87 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 99.87 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 99.87 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 99.87 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 99.87 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 99.87 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 99.87 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 99.86 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 99.86 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 99.86 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.86 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 99.86 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 99.86 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 99.86 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 99.85 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 99.85 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 99.84 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 99.84 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 99.83 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 99.83 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 99.82 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 99.8 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 99.78 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.74 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 99.33 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.18 | |
| 3n75_A | 715 | LDC, lysine decarboxylase, inducible; pyridoxal-5' | 98.21 | |
| 3q7r_A | 121 | Transcriptional regulatory protein; CHXR, receiver | 98.21 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 98.08 | |
| 2yxb_A | 161 | Coenzyme B12-dependent mutase; alpha/beta, structu | 97.98 | |
| 1ccw_A | 137 | Protein (glutamate mutase); coenzyme B12, radical | 97.33 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 96.85 | |
| 2i2x_B | 258 | MTAC, methyltransferase 1; TIM barrel and helix bu | 96.74 | |
| 3ezx_A | 215 | MMCP 1, monomethylamine corrinoid protein 1; N ter | 96.5 | |
| 1y80_A | 210 | Predicted cobalamin binding protein; corrinoid, fa | 96.46 | |
| 2xij_A | 762 | Methylmalonyl-COA mutase, mitochondrial; isomerase | 96.42 | |
| 1req_A | 727 | Methylmalonyl-COA mutase; isomerase, intramolecula | 96.41 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 96.4 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 96.04 | |
| 1xrs_B | 262 | D-lysine 5,6-aminomutase beta subunit; TIM barrel, | 96.0 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 95.74 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 94.86 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 94.56 | |
| 3kp1_A | 763 | D-ornithine aminomutase E component; 5 aminomutase | 94.55 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 94.03 | |
| 3o63_A | 243 | Probable thiamine-phosphate pyrophosphorylase; thi | 94.0 | |
| 3qz6_A | 261 | HPCH/HPAI aldolase; structural genomics, PSI-biolo | 93.55 | |
| 2ekc_A | 262 | AQ_1548, tryptophan synthase alpha chain; structur | 93.55 | |
| 2htm_A | 268 | Thiazole biosynthesis protein THIG; thiamin biosyn | 93.22 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 93.09 | |
| 3bul_A | 579 | Methionine synthase; transferase, reactivation con | 92.88 | |
| 1r8j_A | 289 | KAIA; circadian clock protein; 2.03A {Synechococcu | 92.71 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 92.39 | |
| 1qop_A | 268 | Tryptophan synthase alpha chain; lyase, carbon-oxy | 92.3 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 91.88 | |
| 2lci_A | 134 | Protein OR36; structural genomics, northeast struc | 91.86 | |
| 1wa3_A | 205 | 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, | 91.78 | |
| 2v82_A | 212 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l | 91.29 | |
| 3s83_A | 259 | Ggdef family protein; structural genomics, PSI-bio | 90.88 | |
| 3tqv_A | 287 | Nicotinate-nucleotide pyrophosphorylase; glycosylt | 90.81 | |
| 3inp_A | 246 | D-ribulose-phosphate 3-epimerase; IDP02542, isomer | 90.51 | |
| 3vnd_A | 267 | TSA, tryptophan synthase alpha chain; psychrophili | 90.25 | |
| 3nav_A | 271 | Tryptophan synthase alpha chain; alpha subunit, st | 89.94 | |
| 2xci_A | 374 | KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci | 89.41 | |
| 3rht_A | 259 | (gatase1)-like protein; structural genomics, PSI-b | 89.21 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 89.15 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 88.78 | |
| 1req_B | 637 | Methylmalonyl-COA mutase; isomerase, intramolecula | 88.61 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 88.56 | |
| 1geq_A | 248 | Tryptophan synthase alpha-subunit; hyperthermophIl | 87.88 | |
| 2gek_A | 406 | Phosphatidylinositol mannosyltransferase (PIMA); G | 87.69 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 87.37 | |
| 1mxs_A | 225 | KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a | 87.04 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 87.03 | |
| 3l0g_A | 300 | Nicotinate-nucleotide pyrophosphorylase; ssgcid, N | 86.99 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 86.78 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 86.72 | |
| 4e5v_A | 281 | Putative THUA-like protein; THUA-like proteins, tr | 86.66 | |
| 1ujp_A | 271 | Tryptophan synthase alpha chain; riken structural | 86.61 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 86.33 | |
| 1qpo_A | 284 | Quinolinate acid phosphoribosyl transferase; type | 86.32 | |
| 1wbh_A | 214 | KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} | 86.13 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 86.08 | |
| 3ceu_A | 210 | Thiamine phosphate pyrophosphorylase; TIM barrel-l | 85.69 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 85.57 | |
| 2q5c_A | 196 | NTRC family transcriptional regulator; structural | 85.46 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 85.34 | |
| 2vws_A | 267 | YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escher | 84.84 | |
| 2v5j_A | 287 | 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l | 84.67 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 84.6 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 84.5 | |
| 1wa3_A | 205 | 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, | 84.32 | |
| 3paj_A | 320 | Nicotinate-nucleotide pyrophosphorylase, carboxyl; | 83.82 | |
| 1dxe_A | 256 | 2-dehydro-3-deoxy-galactarate aldolase; class II a | 83.79 | |
| 1xm3_A | 264 | Thiazole biosynthesis protein THIG; structural gen | 83.77 | |
| 2yw3_A | 207 | 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox | 83.68 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 83.61 | |
| 1xi3_A | 215 | Thiamine phosphate pyrophosphorylase; structural g | 83.43 | |
| 2l69_A | 134 | Rossmann 2X3 fold protein; structural genomics, no | 83.27 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 83.13 | |
| 1qdl_B | 195 | Protein (anthranilate synthase (TRPG-SUBUNIT)); tr | 83.01 | |
| 1i1q_B | 192 | Anthranilate synthase component II; tryptophan bio | 82.13 | |
| 1o4u_A | 285 | Type II quinolic acid phosphoribosyltransferase; s | 81.78 | |
| 1qpo_A | 284 | Quinolinate acid phosphoribosyl transferase; type | 81.6 | |
| 2tps_A | 227 | Protein (thiamin phosphate synthase); thiamin bios | 81.57 | |
| 1izc_A | 339 | Macrophomate synthase intermolecular diels-aldera; | 81.57 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 81.47 | |
| 1x1o_A | 286 | Nicotinate-nucleotide pyrophosphorylase; transfera | 81.37 | |
| 2r6o_A | 294 | Putative diguanylate cyclase/phosphodiesterase (G | 81.07 | |
| 1h1y_A | 228 | D-ribulose-5-phosphate 3-epimerase; oxidative pent | 81.03 | |
| 4hjf_A | 340 | Ggdef family protein; structural genomics, PSI-bio | 80.95 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 80.61 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 80.6 |
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
Probab=99.97 E-value=4.1e-29 Score=161.18 Aligned_cols=120 Identities=28% Similarity=0.428 Sum_probs=111.4
Q ss_pred CCcEEEEEeCCHHHHHHHHHHHHhcCCe-EEEecCHHHHHHHHhcCCCccEEEEeCCCCCCCHHHHHHHHHhh--CCCCc
Q 045936 25 RPYFALVVDDDPMIRRIHSMILKSVGFK-VEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIEATKAMRAM--KVESK 101 (145)
Q Consensus 25 ~~~~vlii~~~~~~~~~l~~~l~~~g~~-v~~~~~~~~~l~~l~~~~~~dlil~d~~~~~~~g~~~~~~l~~~--~~~~~ 101 (145)
+.+||||+||++..+..++.+|+..||. +..++++.+|++.++. ..||+||+|++||+++|+++++.||+. .+++|
T Consensus 11 k~~rILiVDD~~~~r~~l~~~L~~~G~~~v~~a~~g~~al~~~~~-~~~DlillD~~MP~mdG~el~~~ir~~~~~~~ip 89 (134)
T 3to5_A 11 KNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKK-GDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLP 89 (134)
T ss_dssp TTCCEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHH-HCCSEEEEESCCSSSCHHHHHHHHHHSTTTTTCC
T ss_pred CCCEEEEEeCCHHHHHHHHHHHHHcCCcEEEEECCHHHHHHHHHh-CCCCEEEEcCCCCCCCHHHHHHHHHhCCCCCCCe
Confidence 5679999999999999999999999986 6689999999999988 579999999999999999999999974 46899
Q ss_pred EEEEecCCChHHHHHHHHhcccEEeeCCCCHHHHHHHHHHHhhC
Q 045936 102 IVGVTSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEELQKN 145 (145)
Q Consensus 102 ii~lt~~~~~~~~~~~~~~g~~~~l~kP~~~~~l~~~l~~~~~~ 145 (145)
||++|+..+.+....+++.|+++|+.||+++++|..++++++++
T Consensus 90 vI~lTa~~~~~~~~~~~~~Ga~~yl~KP~~~~~L~~~i~~~l~R 133 (134)
T 3to5_A 90 VLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFER 133 (134)
T ss_dssp EEEEESSCCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHCC-
T ss_pred EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHhc
Confidence 99999999999999999999999999999999999999998763
|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* | Back alignment and structure |
|---|
| >3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} | Back alignment and structure |
|---|
| >2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A | Back alignment and structure |
|---|
| >1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichii subspshermanii} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A* | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'-deoxyad radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1 | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >3kp1_A D-ornithine aminomutase E component; 5 aminomutase (OAM), metal binding protein; HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_A* 3koy_A* 3koz_A* 3kp0_A* 3kox_A* | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 | Back alignment and structure |
|---|
| >2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bul_A Methionine synthase; transferase, reactivation conformation, cobalamin, intermodular interactions, amino-acid biosynthesis, cobalt; HET: B12; 2.30A {Escherichia coli} SCOP: a.46.1.1 c.23.6.1 d.173.1.1 PDB: 3iv9_A* 3iva_A* 1k7y_A* 1k98_A* 1bmt_A* | Back alignment and structure |
|---|
| >1r8j_A KAIA; circadian clock protein; 2.03A {Synechococcus elongatus pcc 7942} SCOP: a.186.1.1 c.23.1.5 PDB: 1m2e_A 1m2f_A | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >2lci_A Protein OR36; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} | Back alignment and structure |
|---|
| >1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A | Back alignment and structure |
|---|
| >2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* | Back alignment and structure |
|---|
| >3s83_A Ggdef family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, signaling protein; HET: MSE; 1.34A {Caulobacter crescentus} PDB: 3u2e_A | Back alignment and structure |
|---|
| >3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* | Back alignment and structure |
|---|
| >3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >1req_B Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichii subspshermanii} SCOP: c.1.19.1 c.23.6.1 PDB: 1e1c_B* 2req_B* 3req_B* 4req_B* 5req_B* 6req_B* 7req_B* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A | Back alignment and structure |
|---|
| >2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4e5v_A Putative THUA-like protein; THUA-like proteins, trehalose utilisation, structural genomi center for structural genomics, JCSG; 1.75A {Parabacteroides merdae} | Back alignment and structure |
|---|
| >1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} | Back alignment and structure |
|---|
| >1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* | Back alignment and structure |
|---|
| >1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} PDB: 2vwt_A | Back alignment and structure |
|---|
| >2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A | Back alignment and structure |
|---|
| >3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A | Back alignment and structure |
|---|
| >1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A | Back alignment and structure |
|---|
| >2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 | Back alignment and structure |
|---|
| >2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* | Back alignment and structure |
|---|
| >1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* | Back alignment and structure |
|---|
| >2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* | Back alignment and structure |
|---|
| >1izc_A Macrophomate synthase intermolecular diels-aldera; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5 | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2r6o_A Putative diguanylate cyclase/phosphodiesterase (G domains); ggdef and EAL domains, structural genomics, PSI-2; 1.80A {Thiobacillus denitrificans} PDB: 3ii8_A* 3n3t_A* | Back alignment and structure |
|---|
| >1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A | Back alignment and structure |
|---|
| >4hjf_A Ggdef family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, EAL domain, signaling protein; HET: MSE C2E; 1.75A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 145 | ||||
| d1peya_ | 119 | c.23.1.1 (A:) Sporulation response regulator Spo0F | 7e-22 | |
| d1u0sy_ | 118 | c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T | 3e-21 | |
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 9e-21 | |
| d1dz3a_ | 123 | c.23.1.1 (A:) Sporulation response regulator Spo0A | 1e-20 | |
| d2r25b1 | 128 | c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba | 3e-20 | |
| d1zesa1 | 121 | c.23.1.1 (A:3-123) PhoB receiver domain {Escherich | 7e-20 | |
| d1a04a2 | 138 | c.23.1.1 (A:5-142) Nitrate/nitrite response regula | 1e-19 | |
| d1mb3a_ | 123 | c.23.1.1 (A:) Cell division response regulator Div | 2e-18 | |
| d2ayxa1 | 133 | c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C | 3e-18 | |
| d2b4aa1 | 118 | c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba | 4e-18 | |
| d1jbea_ | 128 | c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI | 4e-18 | |
| d1i3ca_ | 144 | c.23.1.1 (A:) Response regulator for cyanobacteria | 6e-18 | |
| d1qkka_ | 140 | c.23.1.1 (A:) Transcriptional regulatory protein D | 7e-18 | |
| d1s8na_ | 190 | c.23.1.1 (A:) Probable two-component system transc | 2e-17 | |
| d1dbwa_ | 123 | c.23.1.1 (A:) Transcriptional regulatory protein F | 2e-17 | |
| d2a9pa1 | 117 | c.23.1.1 (A:2-118) DNA-binding response regulator | 2e-17 | |
| d1zgza1 | 120 | c.23.1.1 (A:2-121) TorCAD operon transcriptional r | 3e-17 | |
| d1ys7a2 | 121 | c.23.1.1 (A:7-127) Transcriptional regulatory prot | 3e-17 | |
| d1a2oa1 | 140 | c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal | 3e-17 | |
| d2pl1a1 | 119 | c.23.1.1 (A:1-119) PhoP receiver domain {Escherich | 7e-17 | |
| d1yioa2 | 128 | c.23.1.1 (A:3-130) Response regulatory protein Sty | 1e-16 | |
| d1xhfa1 | 121 | c.23.1.1 (A:2-122) Aerobic respiration control pro | 2e-16 | |
| d1mvoa_ | 121 | c.23.1.1 (A:) PhoP receiver domain {Bacillus subti | 3e-16 | |
| d1krwa_ | 123 | c.23.1.1 (A:) NTRC receiver domain {Salmonella typ | 5e-16 | |
| d1zh2a1 | 119 | c.23.1.1 (A:2-120) Transcriptional regulatory prot | 8e-16 | |
| d1kgsa2 | 122 | c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog | 1e-15 | |
| d1k68a_ | 140 | c.23.1.1 (A:) Response regulator for cyanobacteria | 2e-15 | |
| d1ny5a1 | 137 | c.23.1.1 (A:1-137) Transcriptional activator sigm5 | 4e-15 | |
| d1p6qa_ | 129 | c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti | 1e-14 | |
| d1k66a_ | 149 | c.23.1.1 (A:) Response regulator for cyanobacteria | 2e-14 | |
| d1w25a1 | 139 | c.23.1.1 (A:2-140) Response regulator PleD, receiv | 1e-13 | |
| d1p2fa2 | 120 | c.23.1.1 (A:1-120) Response regulator DrrB {Thermo | 1e-13 | |
| d1w25a2 | 153 | c.23.1.1 (A:141-293) Response regulator PleD, rece | 6e-12 | |
| d1qo0d_ | 189 | c.23.1.3 (D:) Positive regulator of the amidase op | 2e-10 |
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: Sporulation response regulator Spo0F species: Bacillus subtilis [TaxId: 1423]
Score = 82.3 bits (203), Expect = 7e-22
Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 1/113 (0%)
Query: 30 LVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIEA 89
L+VDD IR + + + G++ A NG +A+D+ + +V +DM++P MDGIE
Sbjct: 5 LIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKE-RPDLVLLDMKIPGMDGIEI 63
Query: 90 TKAMRAMKVESKIVGVTSRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEEL 142
K M+ + +++ +T+ + + G + KP + +I +++
Sbjct: 64 LKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKY 116
|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 99.97 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 99.97 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 99.97 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 99.97 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 99.97 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 99.97 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 99.96 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 99.96 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 99.96 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 99.96 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 99.96 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 99.96 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 99.96 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 99.96 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 99.96 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 99.96 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 99.96 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 99.96 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 99.96 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 99.96 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 99.95 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 99.95 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 99.95 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 99.95 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 99.95 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 99.95 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 99.95 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 99.94 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 99.94 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 99.94 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 99.94 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 99.94 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 99.91 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 99.88 | |
| d1ccwa_ | 137 | Glutamate mutase, small subunit {Clostridium cochl | 97.87 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 97.44 | |
| d1xrsb1 | 160 | D-lysine 5,6-aminomutase beta subunit KamE, C-term | 96.67 | |
| d7reqb2 | 163 | Methylmalonyl-CoA mutase beta subunit, C-terminal | 96.36 | |
| d3bula2 | 156 | Methionine synthase, C-terminal domain {Escherichi | 95.93 | |
| d1wa3a1 | 202 | KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | 95.24 | |
| d1qpoa1 | 169 | Quinolinic acid phosphoribosyltransferase (Nicotin | 95.22 | |
| d1vhca_ | 212 | Hypothetical protein HI0047 {Haemophilus influenza | 95.01 | |
| d1mxsa_ | 216 | KDPG aldolase {Pseudomonas putida [TaxId: 303]} | 94.76 | |
| d1wbha1 | 213 | KDPG aldolase {Escherichia coli [TaxId: 562]} | 94.65 | |
| d1r8ja2 | 135 | N-terminal domain of the circadian clock protein K | 94.49 | |
| d1dxea_ | 253 | 2-dehydro-3-deoxy-galactarate aldolase {Escherichi | 94.32 | |
| d1o4ua1 | 170 | Quinolinic acid phosphoribosyltransferase (Nicotin | 93.8 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 93.46 | |
| d1izca_ | 299 | Macrophomate synthase {Macrophoma commelinae [TaxI | 92.55 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 91.15 | |
| d1xm3a_ | 251 | Thiazole biosynthesis protein ThiG {Bacillus subti | 91.11 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 88.67 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 88.52 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 86.3 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 85.66 | |
| d1i7qb_ | 192 | Anthranilate synthase GAT subunit, TrpG {Serratia | 85.34 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 85.32 | |
| d1qapa1 | 167 | Quinolinic acid phosphoribosyltransferase (Nicotin | 85.2 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 84.86 | |
| d1qapa1 | 167 | Quinolinic acid phosphoribosyltransferase (Nicotin | 84.47 | |
| d1w0ma_ | 226 | Triosephosphate isomerase {Thermoproteus tenax [Ta | 83.16 | |
| d1wl8a1 | 188 | GMP synthase subunit A, GuaAA {Archaeon Pyrococcus | 82.68 | |
| d1qopa_ | 267 | Trp synthase alpha-subunit {Salmonella typhimurium | 82.37 | |
| d1xi3a_ | 206 | Thiamin phosphate synthase {Archaeon (Pyrococcus f | 82.19 | |
| d1vpxa_ | 218 | Decameric fructose-6-phosphate aldolase/transaldol | 82.17 | |
| d2tpsa_ | 226 | Thiamin phosphate synthase {Bacillus subtilis [Tax | 82.03 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 81.83 | |
| d2basa1 | 261 | Hypothetical protein YkuI, N-terminal domain {Baci | 81.82 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 81.23 | |
| d1vc4a_ | 254 | Indole-3-glycerophosphate synthase, IPGS {Thermus | 81.0 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 80.98 | |
| d2ayxa2 | 117 | Sensor kinase protein RcsC {Escherichia coli [TaxI | 80.94 |
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: PhoP receiver domain species: Escherichia coli [TaxId: 562]
Probab=99.97 E-value=2.8e-30 Score=162.13 Aligned_cols=117 Identities=26% Similarity=0.405 Sum_probs=113.0
Q ss_pred cEEEEEeCCHHHHHHHHHHHHhcCCeEEEecCHHHHHHHHhcCCCccEEEEeCCCCCCCHHHHHHHHHhhCCCCcEEEEe
Q 045936 27 YFALVVDDDPMIRRIHSMILKSVGFKVEVAENGKEAVDLFRTGAKFHIVFIDMEMPVMDGIEATKAMRAMKVESKIVGVT 106 (145)
Q Consensus 27 ~~vlii~~~~~~~~~l~~~l~~~g~~v~~~~~~~~~l~~l~~~~~~dlil~d~~~~~~~g~~~~~~l~~~~~~~~ii~lt 106 (145)
+||||+||++..+..+...|+..||.|..+.++++|+..++. ..||+||+|++||+++|+++++.+++..+.+|++++|
T Consensus 1 mrILvVDDd~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~~-~~~dliilD~~mP~~~G~e~~~~i~~~~~~~pvi~lt 79 (119)
T d2pl1a1 1 MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNE-HIPDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILVLT 79 (119)
T ss_dssp CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHH-SCCSEEEECSCCSSSCHHHHHHHHHHTTCCSCEEEEE
T ss_pred CEEEEEeCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHh-cccceeehhccCCCchhHHHHHHHHhcCcccceEeee
Confidence 589999999999999999999999999999999999999998 6799999999999999999999999998999999999
Q ss_pred cCCChHHHHHHHHhcccEEeeCCCCHHHHHHHHHHHhh
Q 045936 107 SRNSETEREVFMQAGLDLCYTKPLTMAKIVPLLEELQK 144 (145)
Q Consensus 107 ~~~~~~~~~~~~~~g~~~~l~kP~~~~~l~~~l~~~~~ 144 (145)
+..+.+....+++.|+++|+.||++.++|..+++++++
T Consensus 80 ~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~v~~~lr 117 (119)
T d2pl1a1 80 ARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMR 117 (119)
T ss_dssp SCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHH
T ss_pred ccCCHHHHHHHHHcCCCEEEECCCCHHHHHHHHHHHHc
Confidence 99999999999999999999999999999999999876
|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} | Back information, alignment and structure |
|---|
| >d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8ja2 c.23.1.5 (A:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2basa1 c.1.33.1 (A:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ayxa2 c.23.1.6 (A:700-816) Sensor kinase protein RcsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|