Citrus Sinensis ID: 045953

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MSDEANRAAFQEIKGRMIENTGKMKQVQNQMRNKEGEKKRAYLTLEELRQLPDNTNTYKSIGRTFVLEPKSVLMNEQEQRLKDSESAIAALQASKEYLEKQKAEVESNLAELLQQDPGLAQQIMSMSVM
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccc
**DEANRAAFQEIKG****************************TLEELRQLPDNTNTYKSIGRTFVLE******************************************************IMSMS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDEANRAAFQEIKGRMIENTGKxxxxxxxxxxxxxxxxxxxxxxxxxxxxPDNTNTYKSIGRTFVLEPKSVLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDPGLAQQIMSMSVM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Prefoldin subunit 1 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.probableQ5D016
Prefoldin subunit 1 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.probableO60925
Probable prefoldin subunit 1 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity). Has a role in gonadogenesis.probableQ17827

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZQM, chain A
Confidence level:confident
Coverage over the Query: 5-116
View the alignment between query and template
View the model in PyMOL