Citrus Sinensis ID: 045997


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60---
LISGKVVAVGPGARDVNGKFIPVSVKEGDTVLLPEYGGAEVKLGDKKYHLYEDESILGTLHDH
ccCEEEEEEccccccccccEEEcccccccEEEcccccccEEEEccCEEEEEEcccEEEEECcc
LISGKVVAVGPGARDVNGKFIPVSVKEGDTVLLPEYGGAEVKLGDKKYHLYEDESILGTLHD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LISGKVVAVGPGARDVNGKFIPVSVKEGDTVLLPEYGGAEVKLGDKKYHLYEDESILGTLHDH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
10 kDa chaperonin Seems to function only as a co-chaperone, along with cpn60, and in certain cases is essential for the discharge of biologically active proteins from cpn60.probableP34893
10 kDa heat shock protein, mitochondrial Eukaryotic CPN10 homolog which is essential for mitochondrial protein biogenesis, together with CPN60. Binds to CPN60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.probableQ64433
10 kDa chaperonin Seems to function only as a co-chaperone, along with cpn60, and in certain cases is essential for the discharge of biologically active proteins from cpn60.probableQ96539

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P3H, chain A
Confidence level:very confident
Coverage over the Query: 2-62
View the alignment between query and template
View the model in PyMOL