Citrus Sinensis ID: 046013

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MATPATLPISNPQTNTTTTTTQTQAPIATPAFRAFLSRLSSSIRYGFSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTLLGLVLAFSLLSHPFSLLVLLCLLGAWIFLYLFRPSDQPVVLFGRTFSDRETLGALVVLTIVVVFLTSVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQEPINSGFLSFLGGAASAAAPSVAARV
cccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccCEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
******L***********************AFRAFLSRLSSSIRYGFSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTLLGLVLAFSLLSHPFSLLVLLCLLGAWIFLYLFRPSDQPVVLFGRTFSDRETLGALVVLTIVVVFLTSVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQEPINSGFLSFLGG*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATPATLPISNPQTNTTTTTTQTQAPIATPAFRAFLSRLSSSIRYGFSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTLLGLVLAFSLLSHPFSLLVLLCLLGAWIFLYLFRPSDQPVVLFGRTFSDRETLGALVVLTIVVVFLTSVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQEPINSGFLSFLGGAASAAAPSVAARV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PRA1 family protein B4 May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.probableO80915
PRA1 family protein B3 May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.probableQ9FLB6
PRA1 family protein B1 May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.probableQ9LYN0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted