Citrus Sinensis ID: 046070


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
EKNSGVQQPHLRREFHSIPEQMSSCYRSYMENYCEEEREALASPDPAAQAQLNQWTEIQDELKKRLITEDFFTWNLPNSTTTNTSTKEEEEVLLKYIGGVDMSFSKEDPSIACGCIVVLDLQTLQIVYEDYSLLRLQVPYVPGFLAFREAPVLLSLLDNMKKRANHFYPQVLMVDGNGLLHPRGFGLASHIGVLANLTTIGVGKNLHHVDGLTHSGVRQLLDAKENNNEDIIPLMGGSGSTWGVAMRSTPDTLKPIFISVGHCISLDTAVMIVKMTCKYRVPEPIRQADIRSRDYLQKHQSTCLLQRWQ
ccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEECccccccccHHHHcHHHHHHHHHHHHHcccccccCEEEEccccccccccccccEEEEEEccccCEEEEccccEECccccccccHHHccccccccccCCcccccccEEEEEEEEcccccccEEEcccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccc
*************************Y*SYMENYCE**************AQLNQWTEIQDELKKRLITEDFFTWNLPNSTT******EEEEVLLKYIGGVDMSFSKEDPSIACGCIVVLDLQTLQIVYEDYSLLRLQVPYVPGFLAFREAPVLLSLLDNMKKRANHFYPQVLMVDGNGLLHPRGFGLASHIGVLANLTTIGVGKNLHHVDGLTHSGVRQLLDAK*NNNEDIIPLMGGSGSTWGVAMRSTPDTLKPIFISVGHCISLDTAVMIVKMTCKYRVPEPIRQADIRSRDYLQK***T*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EKNSGVQQPHLRREFHSIPEQMSSCYRSYMENYCEEEREALASPDPAAQAQLNQWTEIQDELKKRLITEDFFTWNLPNSTTTNTSTKEEEEVLLKYIGGVDMSFSKEDPSIACGCIVVLDLQTLQIVYEDYSLLRLQVPYVPGFLAFREAPVLLSLLDNMKKRANHFYPQVLMVDGNGLLHPRGFGLASHIGVLANLTTIGVGKNLHHVDGLTHSGVRQLLDAKENNNEDIIPLMGGSGSTWGVAMRSTPDTLKPIFISVGHCISLDTAVMIVKMTCKYRVPEPIRQADIRSRDYLQKHQSTCLLQRWQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Endonuclease V Selectively cleaves DNA at the second phosphodiester bond 3' to hypoxanthine- and uracil-containing nucleotides. Shows higher activity towards single-stranded than double-stranded DNA and towards hypoxanthine than uracil.probableQ8N8Q3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GA2, chain A
Confidence level:very confident
Coverage over the Query: 52-74,92-303
View the alignment between query and template
View the model in PyMOL