Citrus Sinensis ID: 046093

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470----
MGRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGETLSLPKMVDVASASAAIDKRKAGKTSRCATKKNKSYIINKDDVTSNVPTQRPQVNGSTSTDDIGNVSAQRPEAYASTDVGYVSTRRPQVNISIDNDANVSTPSHRPEENVSIEEAATPLPATPAQEKEALPRTVIEGCVDLDPYAEDEEILMDPIASNPCQETGLVSSEKRESFVVCSGTEETTMNISILCLCPRGEEEQKETEVLAPFDEDIDAETLCFNNLTDLTEVWTLLEETENCAKNIIREETEIGTRIVANNMAKSEELESANLGATEESVACSSVTSFFDDNNFDWDWESVVQGHDRQCDEENNIFSRPWETDNMAERKSHEIGEVLDYDMPNDMVAWLLS
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHHcccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHccc
cccccccHHcccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHcccccHHHHccccccccccccHHHHcccccccccccccccHHcHccccccHHHcccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccHHHHccccccccccccccHHccccccHHHHHHHHHHHcHHHHHHHcccccHHHHHHcccccccccccccccccccccEEEEccccccccccccccEEEEcccccccccccccccccccccHHHHHccccHccccccccccccccEEEcccccHHHHHHHHc
mgrtpccekvglkkgkwtaKEDEILTKYIQANGIeswrslpkkagllrcgkscRLRWVNYLRTdlrrgnitteEEETIIKLHASLGNRWSViashlpgrtdnelKNYWNTHLSKKihtfqgpvggetlslpkmVDVASASAAIdkrkagktsrcatkknksyiinkddvtsnvptqrpqvngststddignvsaqrpeayastdvgyvstrrpqvnisidndanvstpshrpeenvsieeaatplpatpaqekealprtviegcvdldpyaedeeilmdpiasnpcqetglvssekrESFVVCsgteettmNISILclcprgeeeqketevlapfdedidaetlcFNNLTDLTEVWTLLEETENCAKNIIREETEIGTRIVANNmakseelesanlgateesvacssvtsffddnnfdwdwesvvqghdrqcdeennifsrpwetdnmaerksheigevldydmpndMVAWLLS
mgrtpccekvglkkgkwtakedEILTKYIQangieswrslpkkagllrcgkscrlrwvnylrtdlrrgnitteeEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGETLSLPKMVDVASASaaidkrkagktsrcatkknksyiinkddvtsnvptqrpqvngststddignvsaQRPEAYASTDVGYVSTRRPQVnisidndanvstpshRPEENVSIeeaatplpatpaqekealprtVIEGCVDLDPYAEDEEILMDPIASNPCQETGLVSSEKRESFVVCsgteettmniSILCLCPRGEEEQKETEVLAPFDEDIDAETLCFNNLTDLTEVWTLLEETENCAKNIIREETEIGTRIVANNMAKSEELESANLGATEESVACSSVTSFFDDNNFDWDWESVVQGhdrqcdeennifsrpwetdnmaERKSHeigevldydmpNDMVAWLLS
MGRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNitteeeetiiKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGETLSLPKMVDVASASAAIDKRKAGKTSRCATKKNKSYIINKDDVTSNVPTQRPQVNGSTSTDDIGNVSAQRPEAYASTDVGYVSTRRPQVNISIDNDANVSTPSHRPEENVSIEEaatplpatpaQEKEALPRTVIEGCVDLDPYAEDEEILMDPIASNPCQETGLVSSEKRESFVVCSGTEETTMNISILCLCPRGEEEQKETEVLAPFDEDIDAETLCFNNltdltevwtlleeteNCAKNiireeteigtriVANNMAKSEELESANLGATEESVACSSVTSffddnnfdwdwESVVQGHDRQCDEENNIFSRPWETDNMAERKSHEIGEVLDYDMPNDMVAWLLS
*****CCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGETLSL********************************************************************************************************************************TVIEGCVDLDPYAEDEEILMDPI*****************SFVVCSGTEETTMNISILCLCPRG*******EVLAPFDEDIDAETLCFNNLTDLTEVWTLLEETENCAKNIIREETEIGTRIVAN*******************VACSSVTSFFDDNNFDWDWESVVQGHDRQCD**NNIF****************IGEVLDYDMPNDMVAWL**
*GRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLS********************************************************************************************************************************************************DLDPYAEDEEILMDPIA***********************************************EVLAPFDEDIDAETLCFNNLTDLTEVWTLLEETENCAKNIIREETEIGTRIVANNMA************************FFDDNNFDWDWESVVQGHDRQCDEENNIFSRPWETDNMAERKSHEIGEVLDYDMPNDMVAWLLS
MGRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGETLSLPKMVDVASAS***************TKKNKSYIINKDDVTSNVPTQRPQVNGSTSTDDIGNVSAQRPEAYASTDVGYVSTRRPQVNISIDNDA*************SIEEAATPLPATPAQEKEALPRTVIEGCVDLDPYAEDEEILMDPIASNPCQ*************VVCSGTEETTMNISILCLCPRGEEEQKETEVLAPFDEDIDAETLCFNNLTDLTEVWTLLEETENCAKNIIREETEIGTRIVANNMAKSEELESANLGATEESVACSSVTSFFDDNNFDWDWESVVQGHDRQCDEENNIFSRPWETDNMAERKSHEIGEVLDYDMPNDMVAWLLS
***TPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGE*****************************************************************************D**Y*STRRPQVNISIDNDANVSTPSHRPEENVSIEEAATPLPAT**************************************************SFVVCS*TEETTMNISILCLCPRGEEEQKETEVLAPFDEDIDAETLCFNNLTDLTEVWTLLEETENCAKNIIR******************ELESANLGATEESVACSSVTSFFDDNNFDWDWESVVQGHDRQCDEENNIFSRPWETDNMAERKSHEIGEVLDYDMPNDMVAWLLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGETLSLPKMVDVASASAAIDKRKAGKTSRCATKKNKSYIINKDDVTSNVPTQRPQVNGSTSTDDIGNVSAQRPEAYASTDVGYVSTRRPQVNISIDNDANVSTPSHRPEENVSIEEAATPLPATPAQEKEALPRTVIEGCVDLDPYAEDEEILMDPIASNPCQETGLVSSEKRESFVVCSGTEETTMNISILCLCPRGEEEQKETEVLAPFDEDIDAETLCFNNLTDLTEVWTLLEETENCAKNIIREETEIGTRIVANNMAKSEELESANLGATEESVACSSVTSFFDDNNFDWDWESVVQGHDRQCDEENNIFSRPWETDNMAERKSHEIGEVLDYDMPNDMVAWLLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query474 2.2.26 [Sep-21-2011]
O22264371 Transcription factor MYB1 no no 0.331 0.423 0.647 1e-57
P27898399 Myb-related protein P OS= N/A no 0.253 0.300 0.758 9e-55
Q7XBH4257 Myb-related protein Myb4 no no 0.244 0.451 0.681 2e-46
Q9SZP1282 Transcription repressor M no no 0.244 0.411 0.698 1e-45
P20024340 Myb-related protein Zm1 O N/A no 0.242 0.338 0.695 3e-45
P20026267 Myb-related protein Hv1 O N/A no 0.244 0.434 0.689 4e-45
P81393232 Myb-related protein 308 O N/A no 0.244 0.5 0.689 5e-45
P81395274 Myb-related protein 330 O N/A no 0.244 0.423 0.689 8e-45
P80073421 Myb-related protein Pp2 O N/A no 0.248 0.280 0.644 3e-44
Q8GWP0360 Transcription factor MYB3 no no 0.314 0.413 0.577 3e-44
>sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 Back     alignment and function desciption
 Score =  224 bits (571), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/159 (64%), Positives = 129/159 (81%), Gaps = 2/159 (1%)

Query: 1   MGRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNY 60
           MGR PCCEKVG+K+G+WTA+ED+IL+ YIQ+NG  SWRSLPK AGL RCGKSCRLRW+NY
Sbjct: 1   MGRAPCCEKVGIKRGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINY 60

Query: 61  LRTDLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTF- 119
           LR+DL+RGNIT EEEE ++KLH++LGNRWS+IA HLPGRTDNE+KNYWN+HLS+K+H F 
Sbjct: 61  LRSDLKRGNITPEEEELVVKLHSTLGNRWSLIAGHLPGRTDNEIKNYWNSHLSRKLHNFI 120

Query: 120 QGPVGGETLSLPKMVDVASASAAID-KRKAGKTSRCATK 157
           + P   + +S   M + +SA      KR+ G+TSR A K
Sbjct: 121 RKPSISQDVSAVIMTNASSAPPPPQAKRRLGRTSRSAMK 159
Transcription factor that activates the expression of CHS, CHI, F3H and FLS1. Flavonol-specific activator of flavonoid biosynthesis.
Arabidopsis thaliana (taxid: 3702)
>sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 Back     alignment and function description
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query474
2921336453 MYB-like DNA-binding domain protein [Gos 0.814 0.852 0.412 8e-74
224128372417 predicted protein [Populus trichocarpa] 0.831 0.944 0.420 8e-70
356500104349 PREDICTED: uncharacterized protein LOC10 0.392 0.532 0.621 5e-62
255634947342 unknown [Glycine max] 0.402 0.558 0.587 6e-62
71041100364 MYB22 [Malus x domestica] 0.350 0.456 0.666 4e-61
149728070372 MYB transcription factor MYB112 [Medicag 0.327 0.416 0.697 8e-61
392499125330 MYB4 [Malus hybrid cultivar] 0.350 0.503 0.666 2e-60
327412641379 putative MYB transcription factor [Rosa 0.367 0.459 0.644 1e-59
154425468326 MYB-related protein [Lotus japonicus] 0.369 0.536 0.598 2e-59
324022700533 R2R3-MYB transcription factor [Prunus av 0.335 0.298 0.662 4e-58
>gi|2921336|gb|AAC04718.1| MYB-like DNA-binding domain protein [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  284 bits (726), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 197/478 (41%), Positives = 258/478 (53%), Gaps = 92/478 (19%)

Query: 1   MGRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNY 60
           MGR PCCEKVGLKKG+WTA+ED +LTKYIQANG  SWRSLPK AGLLRCGKSCRLRW+NY
Sbjct: 1   MGRAPCCEKVGLKKGRWTAEEDVLLTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINY 60

Query: 61  LRTDLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQ 120
           LR DL+RGN T++EEE II LHA+LGNRWS+IAS+LPGRTDNE+KNYWN+HLS+KIH+F+
Sbjct: 61  LRADLKRGNFTSQEEEVIINLHATLGNRWSLIASYLPGRTDNEIKNYWNSHLSRKIHSFR 120

Query: 121 GPVGGETLSLPKMVDVASASAAIDKRKAGKTSRCATKKNKSYIINKDDVTSNVPTQRPQV 180
            P+   T S+P ++D+ + +A I KRK G+TS  + K+NKS    KD             
Sbjct: 121 RPL---TQSMPVIMDL-TKTAVIAKRKGGRTSEGSMKENKSCSTQKD------------- 163

Query: 181 NGSTSTDDIGNVSAQRPEAYASTDVGYVSTRRPQVNISIDNDANVSTPSHRPEENVSIEE 240
            GS S     NV     E + ST                                     
Sbjct: 164 TGSCSNKPTENVCVNEVEPFPST------------------------------------- 186

Query: 241 AATPLPATPAQEKEALPRTVIEGCVDLDPYAEDEEILMDPIASNPCQET----GLVSSEK 296
                   P  EKE L  T IE  + LD + ED+E     + S PC +T     L SSE+
Sbjct: 187 --------PLLEKETLSTTAIEDRMVLDQHGEDKERTTHVVPS-PCHDTVVEGMLGSSEE 237

Query: 297 RESFVVCSGTEETTMNISILCLCPRGEEEQKETEVLAPFDEDIDAETLCFNNLTDLTEVW 356
           RES V   GT E +M       CP G  E K T +LAP +    +E   FN++ D     
Sbjct: 238 RESLVTEEGTIENSMQ------CPSGNAE-KGTGILAPHESIDSSEIEWFNDILDS---- 286

Query: 357 TLLEETENCAKNIIREET-EIGTRIVANNMAKSEELESANLGATEESV--ACSSVTSFFD 413
            LL+ + +     + E+   + T   A   A +EE+ S N  A    V  +C+S T +F 
Sbjct: 287 ELLQPSGHLTFTELGEDRWNVKTHTTA---ANNEEIVSRNCSADSGGVLSSCTSTTFYFV 343

Query: 414 DNNFDWDWESVVQGHDRQCDEENNIFSRPWE-TDNMAERKSHEIGEVLDYDMPNDMVA 470
           D     DWE+VV       DE+  + S  WE +D   + + H++ +   ++  N M+A
Sbjct: 344 D-----DWENVVP-RSELWDEKEYMCSWLWEPSDYHGKGERHKVDDN-GFEGHNPMIA 394

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224128372|ref|XP_002320313.1| predicted protein [Populus trichocarpa] gi|222861086|gb|EEE98628.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356500104|ref|XP_003518874.1| PREDICTED: uncharacterized protein LOC100814275 [Glycine max] Back     alignment and taxonomy information
>gi|255634947|gb|ACU17832.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|71041100|gb|AAZ20438.1| MYB22 [Malus x domestica] Back     alignment and taxonomy information
>gi|149728070|gb|ABR28345.1| MYB transcription factor MYB112 [Medicago truncatula] Back     alignment and taxonomy information
>gi|392499125|gb|AFM75823.1| MYB4 [Malus hybrid cultivar] Back     alignment and taxonomy information
>gi|327412641|emb|CCA29109.1| putative MYB transcription factor [Rosa hybrid cultivar] Back     alignment and taxonomy information
>gi|154425468|dbj|BAF74782.1| MYB-related protein [Lotus japonicus] Back     alignment and taxonomy information
>gi|324022700|gb|ADY15306.1| R2R3-MYB transcription factor [Prunus avium] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query474
TAIR|locus:2062040371 MYB12 "myb domain protein 12" 0.474 0.606 0.491 2e-55
TAIR|locus:2155944342 MYB111 "myb domain protein 111 0.343 0.476 0.610 4.2e-55
TAIR|locus:2081735343 MYB11 "myb domain protein 11" 0.341 0.472 0.549 2e-53
TAIR|locus:2174195327 MYB43 "myb domain protein 43" 0.244 0.354 0.655 6.7e-43
TAIR|locus:2038520246 MYB13 "myb domain protein 13" 0.360 0.695 0.5 8.4e-42
TAIR|locus:2149000336 MYB9 "myb domain protein 9" [A 0.244 0.345 0.629 1.5e-41
TAIR|locus:2042526249 MYB14 "myb domain protein 14" 0.356 0.678 0.494 3.6e-41
TAIR|locus:2086233285 MYB15 "myb domain protein 15" 0.337 0.561 0.503 3.6e-41
TAIR|locus:2098906299 MYB17 "myb domain protein 17" 0.244 0.387 0.646 4.6e-41
TAIR|locus:2059883269 MYB7 "myb domain protein 7" [A 0.345 0.609 0.494 5.9e-41
TAIR|locus:2062040 MYB12 "myb domain protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 534 (193.0 bits), Expect = 2.0e-55, Sum P(2) = 2.0e-55
 Identities = 113/230 (49%), Positives = 143/230 (62%)

Query:     1 MGRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNY 60
             MGR PCCEKVG+K+G+WTA+ED+IL+ YIQ+NG  SWRSLPK AGL RCGKSCRLRW+NY
Sbjct:     1 MGRAPCCEKVGIKRGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINY 60

Query:    61 LRTDLRRGNXXXXXXXXXXKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTF- 119
             LR+DL+RGN          KLH++LGNRWS+IA HLPGRTDNE+KNYWN+HLS+K+H F 
Sbjct:    61 LRSDLKRGNITPEEEELVVKLHSTLGNRWSLIAGHLPGRTDNEIKNYWNSHLSRKLHNFI 120

Query:   120 QGPVGGETLSLPKMVDVASASAAID-KRKAGKTSRCATK-KNKSYIINKDDVTSNVPTQR 177
             + P   + +S   M + +SA      KR+ G+TSR A K K       K   TS  P   
Sbjct:   121 RKPSISQDVSAVIMTNASSAPPPPQAKRRLGRTSRSAMKPKIHRTKTRKTKKTSAPPEPN 180

Query:   178 PQVNGSTSTDDIGNVSAQRPEAYASTDVGYVSTRRPQVNISIDNDANVST 227
               V G+    +   V +   EA       Y      +  +SI+ D  V T
Sbjct:   181 ADVAGADK--EALMVESSGAEAELGRPCDYYGDDCNKNLMSINGDNGVLT 228
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0009813 "flavonoid biosynthetic process" evidence=RCA;IMP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0010224 "response to UV-B" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2155944 MYB111 "myb domain protein 111" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081735 MYB11 "myb domain protein 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174195 MYB43 "myb domain protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AtMYB111
AtMYB111 (myb domain protein 111); DNA binding / transcription factor; Member of the R2R3 factor gene family. (342 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT5G44780
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (723 aa)
   •  • 0.659
CESA5
CESA5 (CELLULOSE SYNTHASE 5); cellulose synthase/ transferase, transferring glycosyl groups; En [...] (1069 aa)
   •    0.534
AT3G59300
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (459 aa)
   •    0.534
AT2G31725
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (149 aa)
   •    0.534
PPR40
PPR40 (PENTATRICOPEPTIDE (PPR) DOMAIN PROTEIN 40); Encodes a mitochondrial pentatricopeptide re [...] (659 aa)
   •    0.532
AT1G06530
myosin heavy chain-related; myosin heavy chain-related; LOCATED IN- mitochondrion, plasma membr [...] (323 aa)
   •    0.530
AT3G54970
catalytic; catalytic; FUNCTIONS IN- catalytic activity; INVOLVED IN- metabolic process; LOCATED [...] (353 aa)
   •    0.530
CYP710A3
CYP710A3 (cytochrome P450, family 710, subfamily A, polypeptide 3); electron carrier/ heme bind [...] (493 aa)
   •  • 0.526
AT5G25580
unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unkn [...] (405 aa)
   •    0.524
EMB2083
EMB2083 (embryo defective 2083); ATP binding / ATP-dependent peptidase/ ATPase/ metalloendopept [...] (876 aa)
   •    0.523

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 4e-52
PLN03091459 PLN03091, PLN03091, hypothetical protein; Provisio 7e-46
COG5147512 COG5147, REB1, Myb superfamily proteins, including 2e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-14
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 9e-12
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-07
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-06
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 2e-06
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 4e-06
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  176 bits (447), Expect = 4e-52
 Identities = 75/113 (66%), Positives = 94/113 (83%)

Query: 4   TPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRT 63
           TPCC K+G+K+G WT +EDEIL  +I+  G   WRSLPK+AGLLRCGKSCRLRW+NYLR 
Sbjct: 15  TPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRP 74

Query: 64  DLRRGNITTEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKI 116
            ++RG IT++EE+ I++LH  LGNRWS+IA  +PGRTDNE+KNYWNTHL KK+
Sbjct: 75  SVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKL 127

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 474
PLN03091459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 99.98
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.96
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.95
PLN03212249 Transcription repressor MYB5; Provisional 99.93
PLN03091459 hypothetical protein; Provisional 99.9
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.87
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.77
COG5147512 REB1 Myb superfamily proteins, including transcrip 99.59
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.57
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.49
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.44
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.42
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.29
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.24
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.14
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.06
COG5147512 REB1 Myb superfamily proteins, including transcrip 99.05
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.91
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.88
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.87
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.74
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.37
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.22
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.16
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.14
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.04
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.42
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.4
KOG1279506 consensus Chromatin remodeling factor subunit and 96.3
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.19
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.1
KOG1279506 consensus Chromatin remodeling factor subunit and 96.08
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.03
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 95.78
PRK13923170 putative spore coat protein regulator protein YlbO 95.31
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 94.92
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 94.84
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.78
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.71
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.32
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 92.0
PRK13923170 putative spore coat protein regulator protein YlbO 90.26
PLN031421033 Probable chromatin-remodeling complex ATPase chain 89.58
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 89.07
KOG4282345 consensus Transcription factor GT-2 and related pr 83.65
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-33  Score=292.28  Aligned_cols=124  Identities=57%  Similarity=1.036  Sum_probs=117.4

Q ss_pred             CCCCcccccCCCccCCCCHHHHHHHHHHHHHhCCCCccccccccCCcccccccccccccccCCCCCCCCCChHHHHHHHH
Q 046093            1 MGRTPCCEKVGLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNITTEEEETIIK   80 (474)
Q Consensus         1 mgR~~~~~kp~lkKg~WT~EEDe~L~~lV~kyG~~nW~~IAk~l~~~Rt~kQCr~RW~n~L~p~lkkg~WT~EED~~Ll~   80 (474)
                      |||++||.|++++|++||+|||++|+++|.+||..+|..||+.++.+|+++|||+||.++|+|.+++++||+|||++|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999998745999999999999999999999999999999999


Q ss_pred             HHHHhCCChhHHhhhCCCCCHHHHHHHHHHhhccccccCCCCCC
Q 046093           81 LHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVG  124 (474)
Q Consensus        81 lV~~~G~~W~~IAk~lpgRT~~qcR~RW~~~Lrp~i~~~~~t~e  124 (474)
                      ++.+||.+|..||+.|+|||+++||+||+.+|++.+++......
T Consensus        81 L~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~I~p~  124 (459)
T PLN03091         81 LHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPN  124 (459)
T ss_pred             HHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcCCCCC
Confidence            99999999999999999999999999999999998876544333

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 1e-15
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 3e-15
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 4e-15
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 5e-15
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 5e-15
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 2e-14
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 3e-07
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 1e-06
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-06
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 3e-04
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 9e-04
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 1/105 (0%)
Query: 12  LKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNXX 71
           L KG WT +ED+ + +++Q  G + W  + K     R GK CR RW N+L  ++++ +  
Sbjct: 25  LNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 83
Query: 72  XXXXXXXXKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKI 116
                   + H  LGNRW+ IA  LPGRTDN +KN+WN+ + +K+
Sbjct: 84  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV 128
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-58
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 8e-57
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 8e-57
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 8e-50
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 4e-47
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 4e-47
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 4e-29
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-21
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 6e-04
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-17
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-05
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-16
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-07
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-11
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 7e-06
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 8e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-04
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 2e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-04
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  186 bits (475), Expect = 3e-58
 Identities = 45/105 (42%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 12  LKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNIT 71
           L KG WT +ED+ + K +Q  G + W  + K     R GK CR RW N+L  ++++ + T
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72  TEEEETIIKLHASLGNRWSVIASHLPGRTDNELKNYWNTHLSKKI 116
            EE+  I + H  LGNRW+ IA  LPGRTDN +KN+WN+ + +K+
Sbjct: 61  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 105
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query474
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.98
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.96
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.92
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.92
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.92
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.91
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.8
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.75
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.65
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.65
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.64
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.64
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.63
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.6
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.6
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.6
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.59
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.58
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.58
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.58
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.58
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.58
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.52
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.52
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.51
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.5
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.49
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.48
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.45
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.45
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.45
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.44
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.41
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.4
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.39
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.03
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.26
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.26
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.24
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.24
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.23
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.22
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.8
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.17
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.15
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.98
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.97
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.79
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.74
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.59
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.54
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.53
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.53
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.37
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.32
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.28
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.28
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.19
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.13
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.09
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.05
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.67
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.6
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.48
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.47
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.46
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.36
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.36
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.15
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.01
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.0
2crg_A70 Metastasis associated protein MTA3; transcription 96.96
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 96.96
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.65
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.62
2crg_A70 Metastasis associated protein MTA3; transcription 96.5
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.14
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.09
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.07
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 94.97
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.08
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 92.95
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 90.14
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 90.01
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 83.01
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 82.53
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=7.8e-42  Score=312.83  Aligned_cols=155  Identities=30%  Similarity=0.524  Sum_probs=111.4

Q ss_pred             CCccCCCCHHHHHHHHHHHHHhCCCCccccccccCCcccccccccccccccCCCCCCCCCChHHHHHHHHHHHHhCC-Ch
Q 046093           11 GLKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTDLRRGNITTEEEETIIKLHASLGN-RW   89 (474)
Q Consensus        11 ~lkKg~WT~EEDe~L~~lV~kyG~~nW~~IAk~l~~~Rt~kQCr~RW~n~L~p~lkkg~WT~EED~~Ll~lV~~~G~-~W   89 (474)
                      +++|++||+|||++|+++|.+||..+|..||+.|++ |+++||++||.++|+|.+++++||++||++|+++|.+||. +|
T Consensus         3 ~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W   81 (159)
T 1h89_C            3 HLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPN-RTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRW   81 (159)
T ss_dssp             -----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHcCC-CCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccH
Confidence            378999999999999999999998899999999998 9999999999999999999999999999999999999995 79


Q ss_pred             hHHhhhCCCCCHHHHHHHHHHhhccccccCCCCCCCcccCcchhhhcCCchHHhhccCCCCCchhhhcchhhhhhhc
Q 046093           90 SVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGETLSLPKMVDVASASAAIDKRKAGKTSRCATKKNKSYIINK  166 (474)
Q Consensus        90 ~~IAk~lpgRT~~qcR~RW~~~Lrp~i~~~~~t~eEd~lil~~~~~~G~~Ws~IakrlpGRTdn~iknrw~s~~~~k  166 (474)
                      ..||+.||+||++|||+||.++|+|.+++.+||.+||.+++.++..+|++|+.||+.+||||+++|||||+.+++++
T Consensus        82 ~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia~~l~gRt~~~~knr~~~~~r~~  158 (159)
T 1h89_C           82 SVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK  158 (159)
T ss_dssp             HHHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHHTTSTTCCHHHHHHHHHTTTCC-
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999887654
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 474
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-16
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-15
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-09
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 2e-14
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-13
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 5e-05
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 2e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 9e-08
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 8e-13
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-06
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 1e-12
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 2e-12
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 5e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-05
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-05
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 9e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 7e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 0.002
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 70.9 bits (174), Expect = 2e-16
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 12 LKKGKWTAKEDEILTKYIQANGIESWRSLPKKAGLLRCGKSCRLRWVNYLRTD 64
          L KG WT +ED+ L K +Q  G + W  + K     R GK CR RW N+L  +
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query474
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.66
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.66
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.65
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.65
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.59
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.58
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.58
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.46
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.46
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.43
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.4
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.35
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.35
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.34
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.34
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.32
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.32
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.23
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.23
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.19
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.16
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.09
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.04
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.95
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.92
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.78
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.77
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.58
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.66
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.66
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.53
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.36
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.88
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.76
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.6
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.47
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.2
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 93.18
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 92.28
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 87.34
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.66  E-value=2.3e-17  Score=135.72  Aligned_cols=71  Identities=20%  Similarity=0.245  Sum_probs=66.5

Q ss_pred             CCCCChHHHHHHHHHHHHhCCC------hhHHhhhCCCCCHHHHHHHHHHhhccccccCCCCCCCcccCcchhhhcC
Q 046093           67 RGNITTEEEETIIKLHASLGNR------WSVIASHLPGRTDNELKNYWNTHLSKKIHTFQGPVGGETLSLPKMVDVA  137 (474)
Q Consensus        67 kg~WT~EED~~Ll~lV~~~G~~------W~~IAk~lpgRT~~qcR~RW~~~Lrp~i~~~~~t~eEd~lil~~~~~~G  137 (474)
                      |++||+|||++|+++|.+||..      |..||+.|||||++|||+||+++|.|.+++..|+.+|+.+++..+..+.
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lpgRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~li   77 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLI   77 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTSTTSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCBC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcCCCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhccc
Confidence            6899999999999999999953      9999999999999999999999999999999999999999998876544
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure