Citrus Sinensis ID: 046242

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF
ccccccEEEEEECccccCEEEEEEEcccccHHHHHHHHHHHccEEEEEEEECccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHcccccccccc
*DVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLR*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic probableQ0J709

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NYI, chain A
Confidence level:confident
Coverage over the Query: 15-86
View the alignment between query and template
View the model in PyMOL