Citrus Sinensis ID: 046242


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF
ccccccEEEEEEEccccEEEEEEEEcccccHHHHHHHHHHHccEEEEEEEEEccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHcccccccccc
ccccEEEEEEEEccccccEEEEEEEcccccHHHHHHHHHHHccEEEEEEEEccccHHHHcEEEEEcccccccHHHHHHHHHHHHHHHcccccccccc
vdvdiathisiyddgpnrslLLVETADRPGLLVDLVKIFTVINVnvesgefdtEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYflrrptteeasf
vdvdiathisiyddgpnrsLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFlrrptteeasf
VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF
****IATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLR*********
*DVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYF***********
VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF
VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLRRP*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query97 2.2.26 [Sep-21-2011]
Q0J709283 Unknown protein DS12 from yes no 1.0 0.342 0.824 1e-41
P83643283 Unknown protein DS12 from N/A no 1.0 0.342 0.824 1e-41
>sp|Q0J709|UP12_ORYSJ Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0242700 PE=2 SV=2 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (90%)

Query: 1   VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKA 60
           VDVDIATHI IYDDGP+RSLL+VETADRPGLLVDLVKI   IN+ V+SGEFDTE LLAKA
Sbjct: 187 VDVDIATHIDIYDDGPDRSLLVVETADRPGLLVDLVKIIDDINITVQSGEFDTEGLLAKA 246

Query: 61  KFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF 97
           KFHVSY+G+ +IK LQQVLANSLRYFLRRPTTEE S+
Sbjct: 247 KFHVSYRGKPLIKALQQVLANSLRYFLRRPTTEEGSY 283





Oryza sativa subsp. japonica (taxid: 39947)
>sp|P83643|UP12_ORYSI Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_027381 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
255564051 282 amino acid binding protein, putative [Ri 1.0 0.343 0.896 2e-43
359483143 291 PREDICTED: unknown protein DS12 from 2D- 1.0 0.333 0.855 4e-41
449439743 292 PREDICTED: unknown protein DS12 from 2D- 1.0 0.332 0.845 8e-41
356523245 291 PREDICTED: unknown protein DS12 from 2D- 1.0 0.333 0.855 1e-40
388515911 290 unknown [Lotus japonicus] 1.0 0.334 0.824 3e-40
187608845 283 RecName: Full=Unknown protein DS12 from 1.0 0.342 0.824 6e-40
357145299 281 PREDICTED: unknown protein DS12 from 2D- 1.0 0.345 0.824 7e-40
218200735 280 hypothetical protein OsI_28383 [Oryza sa 1.0 0.346 0.824 7e-40
222640166 280 hypothetical protein OsJ_26556 [Oryza sa 1.0 0.346 0.824 8e-40
326503086 278 predicted protein [Hordeum vulgare subsp 1.0 0.348 0.824 8e-40
>gi|255564051|ref|XP_002523024.1| amino acid binding protein, putative [Ricinus communis] gi|223537746|gb|EEF39366.1| amino acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/97 (89%), Positives = 92/97 (94%)

Query: 1   VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKA 60
           VDVDIATHIS+YDDGP+RSLL VETADRPGLLVDLVKI T INV V+SGEFDTE LLAKA
Sbjct: 186 VDVDIATHISVYDDGPDRSLLFVETADRPGLLVDLVKIITDINVAVDSGEFDTEGLLAKA 245

Query: 61  KFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF 97
           KFHVSYKG+AIIKPLQQVLANSLRYFLRRP+TEEASF
Sbjct: 246 KFHVSYKGKAIIKPLQQVLANSLRYFLRRPSTEEASF 282




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359483143|ref|XP_003632910.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Vitis vinifera] gi|298204773|emb|CBI25271.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449439743|ref|XP_004137645.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356523245|ref|XP_003530251.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|388515911|gb|AFK46017.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|187608845|sp|P83643.2|UP12_ORYSI RecName: Full=Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic; Flags: Precursor gi|187663980|sp|Q0J709.2|UP12_ORYSJ RecName: Full=Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic; Flags: Precursor Back     alignment and taxonomy information
>gi|357145299|ref|XP_003573594.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|218200735|gb|EEC83162.1| hypothetical protein OsI_28383 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|222640166|gb|EEE68298.1| hypothetical protein OsJ_26556 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|326503086|dbj|BAJ99168.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326505920|dbj|BAJ91199.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
TAIR|locus:2015616290 ACR11 "ACT domain repeats 11" 1.0 0.334 0.773 9.2e-36
TAIR|locus:2175458301 ACR12 "ACT domain repeats 12" 1.0 0.322 0.608 5.6e-29
TAIR|locus:2015616 ACR11 "ACT domain repeats 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 386 (140.9 bits), Expect = 9.2e-36, P = 9.2e-36
 Identities = 75/97 (77%), Positives = 89/97 (91%)

Query:     1 VDVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKA 60
             +DVDIATHI+I DDGP+RSLL +E+ADRPGLLV+LVKI + I+V VESGEFDTE LLAK 
Sbjct:   194 IDVDIATHITIEDDGPDRSLLFIESADRPGLLVELVKIISDISVAVESGEFDTEGLLAKV 253

Query:    61 KFHVSYKGEAIIKPLQQVLANSLRYFLRRPTTEEASF 97
             KFHVSY+ +A+IKPLQQVLANSLRYFLRRP+T+E+SF
Sbjct:   254 KFHVSYRNKALIKPLQQVLANSLRYFLRRPSTDESSF 290




GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009409 "response to cold" evidence=IEP;RCA
GO:0010319 "stromule" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IEP
GO:0009744 "response to sucrose stimulus" evidence=IEP
GO:0006833 "water transport" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA
TAIR|locus:2175458 ACR12 "ACT domain repeats 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0J709UP12_ORYSJNo assigned EC number0.82471.00.3427yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 0.002
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
 Score = 33.3 bits (77), Expect = 0.002
 Identities = 10/35 (28%), Positives = 19/35 (54%)

Query: 19 SLLLVETADRPGLLVDLVKIFTVINVNVESGEFDT 53
          +++ V   DRPGLL D+ ++   + +N+      T
Sbjct: 1  TVVEVYAPDRPGLLADITRVLADLGLNIHDARIST 35


This ACT domain family, ACT_UUR_ACR-like, includes the two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the four ACT domains of a novel protein composed almost entirely of ACT domain repeats (the ACR protein) and like proteins. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. This CD also includes the first of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein and related domains, as well as, the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted tyrosine kinase. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 70

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 97
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.97
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.96
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.96
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.94
PRK05007884 PII uridylyl-transferase; Provisional 99.94
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 99.91
PRK04374869 PII uridylyl-transferase; Provisional 99.89
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.87
PRK00275895 glnD PII uridylyl-transferase; Provisional 99.87
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 99.86
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.85
PRK05092931 PII uridylyl-transferase; Provisional 99.84
PRK03381774 PII uridylyl-transferase; Provisional 99.84
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.83
PRK03059856 PII uridylyl-transferase; Provisional 99.82
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.7
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 99.67
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 99.66
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.66
PRK05007 884 PII uridylyl-transferase; Provisional 99.65
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 99.48
PRK05092 931 PII uridylyl-transferase; Provisional 99.4
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 99.37
PRK00275 895 glnD PII uridylyl-transferase; Provisional 99.23
PRK03381774 PII uridylyl-transferase; Provisional 99.19
PRK03059856 PII uridylyl-transferase; Provisional 99.15
PRK04374869 PII uridylyl-transferase; Provisional 99.04
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.99
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 98.78
PRK00227693 glnD PII uridylyl-transferase; Provisional 98.74
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 98.66
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 98.52
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 98.41
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 98.34
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 98.28
PRK0019490 hypothetical protein; Validated 98.25
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 98.24
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 98.19
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 98.14
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 98.03
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 97.99
PRK11589 190 gcvR glycine cleavage system transcriptional repre 97.92
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 97.91
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 97.9
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 97.85
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 97.82
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 97.76
PRK11589190 gcvR glycine cleavage system transcriptional repre 97.73
PRK00227693 glnD PII uridylyl-transferase; Provisional 97.73
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 97.71
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 97.7
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 97.62
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 97.61
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 97.57
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 97.57
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 97.56
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 97.56
COG383090 ACT domain-containing protein [Signal transduction 97.54
cd0211660 ACT ACT domains are commonly involved in specifica 97.5
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 97.49
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 97.41
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 97.41
PRK08577136 hypothetical protein; Provisional 97.37
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 97.37
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 97.31
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 97.21
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 97.21
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 97.21
CHL00100174 ilvH acetohydroxyacid synthase small subunit 97.17
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 97.14
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 97.12
PRK07334403 threonine dehydratase; Provisional 97.08
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 97.04
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 97.01
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 96.91
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 96.86
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 96.86
PRK04435147 hypothetical protein; Provisional 96.7
COG2716176 GcvR Glycine cleavage system regulatory protein [A 96.59
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 96.56
COG2716176 GcvR Glycine cleavage system regulatory protein [A 96.52
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 96.29
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 96.02
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 96.01
PRK11899279 prephenate dehydratase; Provisional 95.89
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 95.87
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 95.81
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 95.8
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 95.78
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 95.73
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 95.33
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 95.21
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 95.04
PRK06349426 homoserine dehydrogenase; Provisional 95.02
PRK10622386 pheA bifunctional chorismate mutase/prephenate deh 94.81
COG0077279 PheA Prephenate dehydratase [Amino acid transport 94.79
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 94.52
PRK08818370 prephenate dehydrogenase; Provisional 94.47
PRK06382406 threonine dehydratase; Provisional 94.1
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 93.59
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 93.26
COG4747142 ACT domain-containing protein [General function pr 93.04
COG4747142 ACT domain-containing protein [General function pr 92.89
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 92.86
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 92.57
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 92.43
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 92.28
COG2150167 Predicted regulator of amino acid metabolism, cont 92.23
cd0493275 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal 91.49
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 91.17
cd0493575 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK 91.06
cd0489161 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- 90.94
COG1707 218 ACT domain-containing protein [General function pr 90.67
PRK06545359 prephenate dehydrogenase; Validated 90.37
cd0486860 ACT_AK-like ACT domains C-terminal to the catalyti 90.36
cd0491966 ACT_AK-Hom3_2 ACT domains located C-terminal to th 90.03
cd0492180 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunc 90.01
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 89.5
PLN02317382 arogenate dehydratase 89.42
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona 89.39
cd0491375 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- 89.05
TIGR01270 464 Trp_5_monoox tryptophan 5-monooxygenase, tetrameri 88.92
PRK08198404 threonine dehydratase; Provisional 88.55
PRK11898283 prephenate dehydratase; Provisional 87.38
KOG2663 309 consensus Acetolactate synthase, small subunit [Am 85.89
TIGR01268 436 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra 85.8
cd0491275 ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter 85.71
cd0493764 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela 85.7
COG397886 Acetolactate synthase (isozyme II), small (regulat 84.36
cd0489265 ACT_AK-like_2 ACT domains C-terminal to the cataly 83.74
cd0491666 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal 83.36
cd0492466 ACT_AK-Arch_2 ACT domains of a monofunctional aspa 82.79
cd0493473 ACT_AK-Hom3_1 CT domains located C-terminal to the 81.98
cd0489062 ACT_AK-like_1 ACT domains found C-terminal to the 81.54
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 81.14
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
Probab=99.97  E-value=1.8e-30  Score=167.23  Aligned_cols=73  Identities=25%  Similarity=0.298  Sum_probs=68.1

Q ss_pred             eEEEEEEeCCcccHHHHHHHHHHhCCeEEEEEEEecCCceeEEEEEEcc-CCCCCChHH-HHHHHHHHHHhcCCC
Q 046242           18 RSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVSY-KGEAIIKPL-QQVLANSLRYFLRRP   90 (97)
Q Consensus        18 ~T~ieV~a~DRpGLL~~I~~~~~~~~l~I~~AkI~T~Gera~DvFyVt~-~g~~L~~~~-~~~L~~~L~~~L~~~   90 (97)
                      +|+|||.|+|||||||+|+++|.++|++|++|||+|.||||+|+|||++ +|.||+++. ++.|+++|.++|.++
T Consensus         1 ~TvveV~~~DRpGLL~~i~~~l~~~~l~I~~A~I~T~gera~D~FyV~d~~g~kl~~~~~~~~l~~~L~~al~~~   75 (75)
T cd04897           1 YSVVTVQCRDRPKLLFDVVCTLTDMDYVVFHATIDTDGDDAHQEYYIRHKDGRTLSTEGERQRVIKCLEAAIERR   75 (75)
T ss_pred             CEEEEEEeCCcCcHHHHHHHHHHhCCeEEEEEEEeecCceEEEEEEEEcCCCCccCCHHHHHHHHHHHHHHHhcC
Confidence            6999999999999999999999999999999999999999999999974 699999774 589999999999763



This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.

>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein Back     alignment and domain information
>cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 Back     alignment and domain information
>cd04921 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PLN02317 arogenate dehydratase Back     alignment and domain information
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins Back     alignment and domain information
>TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PRK11898 prephenate dehydratase; Provisional Back     alignment and domain information
>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
>cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI Back     alignment and domain information
>COG3978 Acetolactate synthase (isozyme II), small (regulatory) subunit [Function unknown] Back     alignment and domain information
>cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) Back     alignment and domain information
>cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains Back     alignment and domain information
>cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 37.5 bits (86), Expect = 3e-04
 Identities = 15/98 (15%), Positives = 37/98 (37%), Gaps = 16/98 (16%)

Query: 2   DVDIATHISIYDDGPNRSLLLVETADRPGLLVDLVKIFTVINVNVES-----GEFDTEEL 56
           +V  A   + ++       +L+ T  +   + D +   T  +++++         + + L
Sbjct: 252 NVQNAKAWNAFN---LSCKILLTTRFKQ--VTDFLSAATTTHISLDHHSMTLTPDEVKSL 306

Query: 57  LAKAKFHVSYKG---EAI-IKPLQ-QVLANSLRYFLRR 89
           L K       +    E +   P +  ++A S+R  L  
Sbjct: 307 LLKY-LDCRPQDLPREVLTTNPRRLSIIAESIRDGLAT 343


>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
2nyi_A195 Unknown protein; protein structure initiative, PSI 99.23
1u8s_A192 Glycine cleavage system transcriptional repressor, 99.05
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 98.69
1u8s_A 192 Glycine cleavage system transcriptional repressor, 98.59
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 98.55
2nyi_A 195 Unknown protein; protein structure initiative, PSI 98.43
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 98.08
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 97.74
2pc6_A165 Probable acetolactate synthase isozyme III (small; 97.57
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 97.38
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 97.26
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 97.16
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 97.14
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 97.11
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 97.04
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 96.95
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 96.94
2f06_A144 Conserved hypothetical protein; structural genomic 95.85
2f06_A144 Conserved hypothetical protein; structural genomic 95.63
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition 95.32
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 94.96
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 94.88
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 94.54
3luy_A329 Probable chorismate mutase; structural genomics, A 94.52
3mwb_A313 Prephenate dehydratase; L-Phe, PSI, MCSG, structur 94.41
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 93.74
2qmw_A267 PDT, prephenate dehydratase; APC85812, prephenate 93.54
2re1_A167 Aspartokinase, alpha and beta subunits; structural 93.05
2re1_A167 Aspartokinase, alpha and beta subunits; structural 92.93
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 91.62
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 91.5
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 91.25
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 88.97
4go7_X200 Aspartokinase; transferase; 2.00A {Mycobacterium t 87.83
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 87.24
1phz_A 429 Protein (phenylalanine hydroxylase); aromatic amin 84.01
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 83.45
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
Probab=99.23  E-value=8.4e-12  Score=89.50  Aligned_cols=70  Identities=16%  Similarity=0.151  Sum_probs=57.6

Q ss_pred             CCCeEEEEEEeCCcccHHHHHHHHHHhCCeEEEEEEEecCC--ceeEEEEEEcc-CCCCCChHHHHHHHHHHHHh
Q 046242           15 GPNRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEE--LLAKAKFHVSY-KGEAIIKPLQQVLANSLRYF   86 (97)
Q Consensus        15 ~~~~T~ieV~a~DRpGLL~~I~~~~~~~~l~I~~AkI~T~G--era~DvFyVt~-~g~~L~~~~~~~L~~~L~~~   86 (97)
                      +..+++|+|.++|||||+++|+++|.++|+||..+++.|.+  ++++|.||+.. .+.+ .+.. +.|+++|...
T Consensus        90 ~~~~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~t~~~~~~~~~~F~m~~~~~~~-~~~~-~~l~~~l~~~  162 (195)
T 2nyi_A           90 DTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRMGSRVAFP-FPLY-QEVVTALSRV  162 (195)
T ss_dssp             TEEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTCEEEEEEEEEEEE-GGGH-HHHHHHHHHH
T ss_pred             CCcEEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceeeecccccCCCCeEEEEEEEEcC-CCcc-HHHHHHHHHH
Confidence            55689999999999999999999999999999999999999  99999999963 2333 1223 5666766643



>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 98.76
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 98.61
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 98.29
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 98.19
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 98.13
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 98.11
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 97.53
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 97.49
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 97.36
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 97.28
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 97.2
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 97.18
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 96.51
d2cdqa291 Aspartokinase {Thale cress (Arabidopsis thaliana) 93.54
d2hmfa3100 Aspartokinase {Methanococcus jannaschii [TaxId: 21 91.46
d2hmfa267 Aspartokinase {Methanococcus jannaschii [TaxId: 21 90.32
d2cdqa375 Aspartokinase {Thale cress (Arabidopsis thaliana) 85.29
d3ceda195 Methionine import ATP-binding protein MetN2 {Staph 84.29
d1zvpa264 Hypothetical protein VC0802 {Vibrio cholerae [TaxI 80.99
d1zhva266 Hypothetical protein Atu0741 {Agrobacterium tumefa 80.46
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Glycine cleavage system transcriptional repressor
domain: putative transcriptional repressor VC2159
species: Vibrio cholerae [TaxId: 666]
Probab=98.76  E-value=2.9e-08  Score=61.60  Aligned_cols=49  Identities=16%  Similarity=0.223  Sum_probs=45.6

Q ss_pred             CeEEEEEEeCCcccHHHHHHHHHHhCCeEEEEEEEecCCceeEEEEEEc
Q 046242           17 NRSLLLVETADRPGLLVDLVKIFTVINVNVESGEFDTEELLAKAKFHVS   65 (97)
Q Consensus        17 ~~T~ieV~a~DRpGLL~~I~~~~~~~~l~I~~AkI~T~Gera~DvFyVt   65 (97)
                      ++.+|.|.++||||++++|++++.++|.||..++-.+.|.+..=.+.|+
T Consensus         4 ~~~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~~~~~~~~~~v~   52 (86)
T d1u8sa1           4 QHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLIS   52 (86)
T ss_dssp             EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEE
T ss_pred             cEEEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEECCeeEEEEEEE
Confidence            4789999999999999999999999999999999999999888777775



>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3ceda1 d.58.18.13 (A:247-341) Methionine import ATP-binding protein MetN2 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zvpa2 d.58.18.9 (A:68-131) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure