Catalytic component of the COMPASS (Set1C) complex that specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently plays a role in telomere length maintenance and transcription elongation regulation.
Score = 69.7 bits (169), Expect = 5e-12, Method: Composition-based stats.
Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
Query: 2 PNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDYLFDPDEPEEFKVPCLCKAPNCRKFM 61
PNC I+ V D + RI++ AK + G+EL+YDY FD E E K+PC C APNCRK+M
Sbjct: 2373 PNCVTEIVEV-DRDVRIIIFAKRKIYRGEELSYDYKFDI-EDESHKIPCACGAPNCRKWM 2430
Query: 62 N 62
N
Sbjct: 2431 N 2431
Histone methyltransferase that acts as a coactivator for the ecdysone receptor during development. Specifically trimethylates 'Lys-4' of histone H3, a specific tag for epigenetic transcriptional activation. Recruited by EcR in an ecdysone-dependent manner causing H3 'Lys-4' trimethylation at ecdysone-inducible promoters, leading to activate expression. Plays a central role in the developing compound eye, during the progression of the morphogenetic furrow and in post-furrow differentiation of the retinal epithelium, notably by activating expression of hh.
Catalytic component of the COMPASS (Set1C) complex that specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently plays a role in telomere length maintenance and transcription elongation regulation.
Catalytic component of the COMPASS (Set1C) complex that specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently plays a role in telomere length maintenance and transcription elongation regulation.
Catalytic component of the COMPASS (Set1C) complex that specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently plays a role in telomere length maintenance and transcription elongation regulation.
Score = 61.2 bits (147), Expect = 2e-09, Method: Composition-based stats.
Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
Query: 2 PNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDYLFDPDEPEEFKVPCLCKAPNCRKFM 61
P+C A+I+ V D RIV+ A ++ +ELTYDY F+ + E ++PCLC AP+C+ F+
Sbjct: 941 PSCTAKIIKV-DGRKRIVIYALRDIGTNEELTYDYKFERETDEGERLPCLCGAPSCKGFL 999
Query: 62 N 62
N
Sbjct: 1000 N 1000
Catalytic component of the COMPASS (Set1C) complex that specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently plays a role in telomere length maintenance and transcription elongation regulation.
Score = 156 (60.0 bits), Expect = 7.2e-11, P = 7.2e-11
Identities = 29/61 (47%), Positives = 40/61 (65%)
Query: 2 PNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDYLFDPDEPEEFKVPCLCKAPNCRKFM 61
PNCY+R++++ D + IV+ A + G+ELTYDY F P E K+PC C A CRKF+
Sbjct: 265 PNCYSRVINI-DGQKHIVIFAMRKIYRGEELTYDYKF-PIEDASNKLPCNCGAKKCRKFL 322
Query: 62 N 62
N
Sbjct: 323 N 323
GO:0051569 "regulation of histone H3-K4 methylation" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
Score = 156 (60.0 bits), Expect = 4.8e-10, P = 4.8e-10
Identities = 29/61 (47%), Positives = 40/61 (65%)
Query: 2 PNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDYLFDPDEPEEFKVPCLCKAPNCRKFM 61
PNCY+R++++ D + IV+ A + G+ELTYDY F P E K+PC C A CRKF+
Sbjct: 891 PNCYSRVINI-DGQKHIVIFAMRKIYRGEELTYDYKF-PIEDASNKLPCNCGAKKCRKFL 948
Query: 62 N 62
N
Sbjct: 949 N 949
Score = 39.4 bits (92), Expect = 7e-06
Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
Query: 2 PNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDY 36
PNC R + V + RIV+ A ++ G+ELT DY
Sbjct: 79 PNCEVRFVFVNGGD-RIVVRALRDIKPGEELTIDY 112
SET domains are protein lysine methyltransferase enzymes. SET domains appear to be protein-protein interaction domains. It has been demonstrated that SET domains mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). A subset of SET domains have been called PR domains. These domains are divergent in sequence from other SET domains, but also appear to mediate protein-protein interaction. The SET domain consists of two regions known as SET-N and SET-C. SET-C forms an unusual and conserved knot-like structure of probably functional importance. Additionally to SET-N and SET-C, an insert region (SET-I) and flanking regions of high structural variability form part of the overall structure. Length = 113
>gnl|CDD|225491 COG2940, COG2940, Proteins containing SET domain [General function prediction only]
>KOG4442 consensus Clathrin coat binding protein/Huntingtin interacting protein HIP1, involved in regulation of endocytosis [Intracellular trafficking, secretion, and vesicular transport]
>PF00856 SET: SET domain; InterPro: IPR001214 The SET domain appears generally as one part of a larger multidomain protein, and recently there were described three structures of very different proteins with distinct domain compositions: Neurospora crassa DIM-5, a member of the Su(var) family of HKMTs which methylate histone H3 on lysine 9,human SET7 (also called SET9), which methylates H3 on lysine 4 and garden pea Rubisco LSMT, an enzyme that does not modify histones, but instead methylates lysine 14 in the flexible tail of the large subunit of the enzyme Rubisco
The SET domain itself turned out to be an uncommon structure. Although in all three studies, electron density maps revealed the location of the AdoMet or AdoHcy cofactor, the SET domain bears no similarity at all to the canonical/AdoMet-dependent methyltransferase fold. Strictly conserved in the C-terminal motif of the SET domain tyrosine could be involved in abstracting a proton from the protonated amino group of the substrate lysine, promoting its nucleophilic attack on the sulphonium methyl group of the AdoMet cofactor. In contrast to the AdoMet-dependent protein methyltranferases of the classical type, which tend to bind their polypeptide substrates on top of the cofactor, it is noted from the Rubisco LSMT structure that the AdoMet seems to bind in a separate cleft, suggesting how a polypeptide substrate could be subjected to multiple rounds of methylation without having to be released from the enzyme. In contrast, SET7/9 is able to add only a single methyl group to its substrate. It has been demonstrated that association of SET domain and myotubularin-related proteins modulates growth control []. The SET domain-containing Drosophila melanogaster (Fruit fly) protein, enhancer of zeste, has a function in segment determination and the mammalian homologue may be involved in the regulation of gene transcription and chromatin structure. Histone lysine methylation is part of the histone code that regulated chromatin function and epigenetic control of gene function. Histone lysine methyltransferases (HMTase) differ both in their substrate specificity for the various acceptor lysines as well as in their product specificity for the number of methyl groups (one, two, or three) they transfer. With just one exception [], the HMTases belong to SET family that can be classified according to the sequences surrounding the SET domain [, ]. Structural studies on the human SET7/9, a mono-methylase, have revealed the molecular basis for the specificity of the enzyme for the histone-target and the roles of the invariant residues in the SET domain in determining the methylation specificities []. The pre-SET domain, as found in the SUV39 SET family, contains nine invariant cysteine residues that are grouped into two segments separated by a region of variable length. These 9 cysteines coordinate 3 zinc ions to form to form a triangular cluster, where each of the zinc ions is coordinated by 4 four cysteines to give a tetrahedral configuration. The function of this domain is structural, holding together 2 long segments of random coils. The C-terminal region including the post-SET domain is disordered when not interacting with a histone tail and in the absence of zinc. The three conserved cysteines in the post-SET domain form a zinc-binding site when coupled to a fourth conserved cysteine in the knot-like structure close to the SET domain active site []. The structured post-SET region brings in the C-terminal residues that participate in S-adenosylmethine-binding and histone tail interactions. The three conserved cysteine residues are essential for HMTase activity, as replacement with serine abolishes HMTase activity [], []. ; GO: 0005515 protein binding; PDB: 3TG5_A 3S7F_A 3RIB_B 3TG4_A 3S7J_A 3S7D_A 3S7B_A 3H6L_A 3SMT_A 3K5K_A ....
>smart00508 PostSET Cysteine-rich motif following a subset of SET domains
>PF08666 SAF: SAF domain; InterPro: IPR013974 This entry includes a range of different proteins, such as antifreeze proteins, flagellar FlgA proteins, and CpaB pilus proteins
>PF00856 SET: SET domain; InterPro: IPR001214 The SET domain appears generally as one part of a larger multidomain protein, and recently there were described three structures of very different proteins with distinct domain compositions: Neurospora crassa DIM-5, a member of the Su(var) family of HKMTs which methylate histone H3 on lysine 9,human SET7 (also called SET9), which methylates H3 on lysine 4 and garden pea Rubisco LSMT, an enzyme that does not modify histones, but instead methylates lysine 14 in the flexible tail of the large subunit of the enzyme Rubisco
The SET domain itself turned out to be an uncommon structure. Although in all three studies, electron density maps revealed the location of the AdoMet or AdoHcy cofactor, the SET domain bears no similarity at all to the canonical/AdoMet-dependent methyltransferase fold. Strictly conserved in the C-terminal motif of the SET domain tyrosine could be involved in abstracting a proton from the protonated amino group of the substrate lysine, promoting its nucleophilic attack on the sulphonium methyl group of the AdoMet cofactor. In contrast to the AdoMet-dependent protein methyltranferases of the classical type, which tend to bind their polypeptide substrates on top of the cofactor, it is noted from the Rubisco LSMT structure that the AdoMet seems to bind in a separate cleft, suggesting how a polypeptide substrate could be subjected to multiple rounds of methylation without having to be released from the enzyme. In contrast, SET7/9 is able to add only a single methyl group to its substrate. It has been demonstrated that association of SET domain and myotubularin-related proteins modulates growth control []. The SET domain-containing Drosophila melanogaster (Fruit fly) protein, enhancer of zeste, has a function in segment determination and the mammalian homologue may be involved in the regulation of gene transcription and chromatin structure. Histone lysine methylation is part of the histone code that regulated chromatin function and epigenetic control of gene function. Histone lysine methyltransferases (HMTase) differ both in their substrate specificity for the various acceptor lysines as well as in their product specificity for the number of methyl groups (one, two, or three) they transfer. With just one exception [], the HMTases belong to SET family that can be classified according to the sequences surrounding the SET domain [, ]. Structural studies on the human SET7/9, a mono-methylase, have revealed the molecular basis for the specificity of the enzyme for the histone-target and the roles of the invariant residues in the SET domain in determining the methylation specificities []. The pre-SET domain, as found in the SUV39 SET family, contains nine invariant cysteine residues that are grouped into two segments separated by a region of variable length. These 9 cysteines coordinate 3 zinc ions to form to form a triangular cluster, where each of the zinc ions is coordinated by 4 four cysteines to give a tetrahedral configuration. The function of this domain is structural, holding together 2 long segments of random coils. The C-terminal region including the post-SET domain is disordered when not interacting with a histone tail and in the absence of zinc. The three conserved cysteines in the post-SET domain form a zinc-binding site when coupled to a fourth conserved cysteine in the knot-like structure close to the SET domain active site []. The structured post-SET region brings in the C-terminal residues that participate in S-adenosylmethine-binding and histone tail interactions. The three conserved cysteine residues are essential for HMTase activity, as replacement with serine abolishes HMTase activity [], []. ; GO: 0005515 protein binding; PDB: 3TG5_A 3S7F_A 3RIB_B 3TG4_A 3S7J_A 3S7D_A 3S7B_A 3H6L_A 3SMT_A 3K5K_A ....
>KOG1337 consensus N-methyltransferase [General function prediction only]
This family is a subset of the Pfam model pfam03102 and is believed to include only authentic NeuB N-acetylneuraminate (sialic acid) synthase enzymes. The majority of the genes identified by this model are observed adjacent to both the NeuA and NeuC genes which together effect the biosynthesis of CMP-N-acetylneuraminate from UDP-N-acetylglucosamine.
>TIGR02059 swm_rep_I cyanobacterial long protein repeat
This domain appears in 29 copies in a large (10000 amino protein in Synechococcus sp. WH8102 associated with a novel flagellar system, as one of three different repeats. Similar domains are found in two different large (<3500) proteins of Synechocystis PCC6803.
>COG1188 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis]
>pdb|3OOI|A Chain A, Crystal Structure Of Human Histone-Lysine N-Methyltransferase Nsd1 Set Domain In Complex With S-Adenosyl-L-Methionine Length = 232
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*
class: All beta proteins
fold: beta-clip
superfamily: AFP III-like domain
family: AFP III-like domain
domain: Type III antifreeze protein, AFP III
species: Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]
