Citrus Sinensis ID: 046286


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MEGREPHPVSSPMSPQPNYLFTPSIPSSSMQPATLEPQVLPEIDWVSLLSAQSTDHNMMESTSHLNPENGGGRDQQDQGCKENKRKGSRMKKATRPRFAFQTRSADDILDDGYRWRKYGQKAVKNSLYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHPCEKLMETLTPLLKQMQFLARF
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccEEcccccccccccccccccccccEEEEEcccccccccccHHHHHHHHHHccccccc
***************************************************************************************************FQTRSADDILDDGYRWRKYGQKAVKNSLYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNH**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGREPHPVSSPMSPQPNYLFTPSIPSSSMQPATLEPQVLPEIDWVSLLSAQSTDHNMMESTSHLNPENGGGRDQQDQGCKENKRKGSRMKKATRPRFAFQTRSADDILDDGYRWRKYGQKAVKNSLYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHPCEKLMETLTPLLKQMQFLARF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable WRKY transcription factor 43 Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element.probableQ8GY11

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AYD, chain A
Confidence level:very confident
Coverage over the Query: 96-170
View the alignment between query and template
View the model in PyMOL