Citrus Sinensis ID: 046301


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKWVNSTTSSDSG
cccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHHHcccccccccHHHHHccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccCECcccccEEEcccHHHHHHHHHccccEEECccccccccccccccEEEEEEEEcccccccccccccccccccEEEEccccccccccccHHHHHHHHcccccccEEEccccccccccccccccccccEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHHccccccccEEEEccccccccHHHHHHHccccccccccEEEEEcccccccccc
HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWD**NERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKW**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENxxxxxxxxxxxxxxxxxxxxxSLKWVNSTTSSDSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 254-396
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 199-338
View the alignment between query and template
View the model in PyMOL
Template: 1Z6T, chain A
Confidence level:very confident
Coverage over the Query: 4-126,139-179
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:confident
Coverage over the Query: 1-184
View the alignment between query and template
View the model in PyMOL