Citrus Sinensis ID: 046301


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKWVNSTTSSDSG
cccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHHHcccccccccHHHHHccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEEcccccEEEcccHHHHHHHHHHcccEEEEccccccccccccccEEEEEEEEcccccccccccccccccccEEEEccccccccccccHHHHHHHHcccccccEEEccccccccccccccccccccEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHHccccccccEEEEccccccccHHHHHHHccccccccccEEEEEcccccccccc
cccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHcHHccccccccccHHHHHEEHHccccHHHHHHHEHEcccccccccHHHHHHHHHHHcHcccccccccHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHcccEEEEEcccccccccccccccEEEEEEEcccccHccccHHHHcHccccEEEEccccccccccccHHHHHHHHHHHcEEEEEEccccccccccccHccHHHHHEEEcccccccccccccccccHcccEEcEEEEccccccHHccccccccHHHHHcccEEEEcccccccHHHHHHHHHcccEEEEccccccccHHHHHHHcccccccccEEEEEEcccccccccc
hslrnllrddclcifvqhslgrtdFVAHQYLSEIGEKIvdrcngsplAAKTLGSLlrdkydpkdweDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYcsflpkgyrfdeRQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSrsffqwskidasrFLMHDLIHDLACWafgeisssmestwdgnnerrfsRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTrktfyvtnnlvfhvvprLRQLRVVSLCGYKIVQLPNDIAELKhlryldfshtaievlpesklfpdvgnlvnlrHLKDSHSNLLeemplrigklTSLRTLAKFVVgkgncyglKELRSLMHLQEKLTIsglenvndaeDAKEAQLNGKEKLEALSLKWvnsttssdsg
HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEkivdrcngSPLAAKTLGsllrdkydpkDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKeklealslkwvnsttssdsg
HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKWVNSTTSSDSG
*****LLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSS***TWD****RRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGL*************************************
HSLRNLLRDDCLCIFVQHSLGRTD*VAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWD**NERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKW**********
HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKWV*********
**LRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKWVN********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVGKGNCYGLKELRSLMHLQEKLTISGLENxxxxxxxxxxxxxxxxxxxxxSLKWVNSTTSSDSG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query404 2.2.26 [Sep-21-2011]
Q9LRR4 1054 Putative disease resistan yes no 0.980 0.375 0.404 7e-78
Q9LRR5 1424 Putative disease resistan no no 0.955 0.271 0.358 5e-58
Q7XBQ9 970 Disease resistance protei N/A no 0.928 0.386 0.365 2e-54
Q7XA42 979 Putative disease resistan N/A no 0.910 0.375 0.350 3e-51
Q7XA39 988 Putative disease resistan N/A no 0.881 0.360 0.355 2e-50
Q7XA40 992 Putative disease resistan N/A no 0.928 0.378 0.346 3e-50
Q39214 926 Disease resistance protei no no 0.797 0.347 0.271 1e-24
O82484 892 Putative disease resistan no no 0.757 0.343 0.261 9e-21
Q8W474 907 Probable disease resistan no no 0.650 0.289 0.272 1e-19
O81825 919 Probable disease resistan no no 0.811 0.356 0.254 2e-19
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  291 bits (744), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 172/425 (40%), Positives = 246/425 (57%), Gaps = 29/425 (6%)

Query: 1   HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKY 60
           H+L+ L   DC  +F++   G  +   ++ + ++ E+IV +C G PLA KTLG +LR + 
Sbjct: 329 HNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPLAVKTLGGVLRFEG 388

Query: 61  DPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIV 120
              +WE VL+S+IWDL  D+S+++  LRVSY+YLP+++KRCFAYCS  PKG+ F++ ++V
Sbjct: 389 KVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVV 448

Query: 121 LLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFG 180
           LLWMAEG LQ     K +EELG + F  L SRS  Q +K   +R++MHD I++LA +A G
Sbjct: 449 LLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTK---TRYIMHDFINELAQFASG 505

Query: 181 EISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKT 240
           E SS  E   DG  + + S   R+LSYL   +     FE L +V++LRTFL L L     
Sbjct: 506 EFSSKFE---DG-CKLQVSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSR 561

Query: 241 FYVTNNLVFH-VVPRLRQLRVVSLCGYKIVQLPND-IAELKHLRYLDFSHTAIEVLPES- 297
               + +V   ++P L +LRV+SL  YKI +LP D    + H R+LD S T +E LP+S 
Sbjct: 562 SCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSL 621

Query: 298 ------------------KLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKF 339
                             +L  D+ NL+NLR+L D     L +MP R G+L SL+TL  F
Sbjct: 622 CYMYNLQTLLLSYCSSLKELPTDISNLINLRYL-DLIGTKLRQMPRRFGRLKSLQTLTTF 680

Query: 340 VVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKWVNSTT 399
            V   +   + EL  L  L  KL I  L+ V D  DA EA LN K+ L  +   W   ++
Sbjct: 681 FVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRTGSS 740

Query: 400 SSDSG 404
           SS++ 
Sbjct: 741 SSENN 745




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query404
296090374 908 unnamed protein product [Vitis vinifera] 0.975 0.433 0.475 1e-100
225449649 1418 PREDICTED: putative disease resistance p 0.975 0.277 0.475 1e-100
147819724 1481 hypothetical protein VITISV_007111 [Viti 0.972 0.265 0.453 3e-97
225450019 1394 PREDICTED: putative disease resistance p 0.972 0.281 0.453 3e-97
297736321 967 unnamed protein product [Vitis vinifera] 0.972 0.406 0.453 6e-97
225450001 1389 PREDICTED: putative disease resistance p 0.975 0.283 0.471 2e-96
359497792 843 PREDICTED: putative disease resistance R 0.987 0.473 0.447 1e-95
147862409 1466 hypothetical protein VITISV_042289 [Viti 0.980 0.270 0.435 2e-95
225450003 1452 PREDICTED: putative disease resistance R 0.972 0.270 0.465 5e-95
359487172 1310 PREDICTED: putative disease resistance R 0.975 0.300 0.431 1e-94
>gi|296090374|emb|CBI40193.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  372 bits (955), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/416 (47%), Positives = 272/416 (65%), Gaps = 22/416 (5%)

Query: 1   HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKY 60
           H ++ L  DDC  +FVQH+    +  AH  L  IG+KIV +C G PLAAKTLG LLR K 
Sbjct: 8   HYVKALSYDDCWSVFVQHAFENRNICAHPSLEVIGKKIVQKCGGLPLAAKTLGGLLRSKS 67

Query: 61  DPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIV 120
              +WEDVL SKIW+  +  S I+ ALR+SYHYLPS++KRCFAYCS  PK Y FD++++V
Sbjct: 68  KDDEWEDVLYSKIWNFPDKESDILPALRLSYHYLPSHLKRCFAYCSIFPKDYEFDKKELV 127

Query: 121 LLWMAEGLLQHETYG-KQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAF 179
           LLWMAEGL+Q    G KQME++G   F  L SRSFFQ S  + SRF+MHDLI+DLA +  
Sbjct: 128 LLWMAEGLIQQSPKGKKQMEDMGSDYFCELLSRSFFQLSSCNGSRFVMHDLINDLAQYVS 187

Query: 180 GEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTR- 238
            EI   +E + D N +  FS ++RH S+   +++  ++FE  +K + LRTFLAL +  + 
Sbjct: 188 EEICFHLEDSLDSNQKHTFSGSVRHSSFARCKYEVFRKFEDFYKAKNLRTFLALPIHMQY 247

Query: 239 -KTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLDFSHTAIEVLPES 297
              F++T+ +   ++P+LR LRV+SL  Y+I +LPN I +LKHLRYL+ S T I+ LP+S
Sbjct: 248 YDFFHLTDKVSHDLLPKLRYLRVLSLSHYEIRELPNSIGDLKHLRYLNLSCTIIQELPDS 307

Query: 298 -------------------KLFPDVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAK 338
                              +L     NL+NLRHL  +H++ LE MP ++GKL SL+TL+K
Sbjct: 308 LSDLHNLQTLVLFRCRRLNRLPRGFKNLINLRHLDIAHTHQLEVMPPQMGKLKSLQTLSK 367

Query: 339 FVVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKW 394
           F+VGK    G+KEL  L+HL+ KL+I  L+NV D +DA++A L  K  LE L ++W
Sbjct: 368 FIVGKSKELGIKELGDLLHLRGKLSILDLQNVVDIQDARDANLKDKHHLEELLMEW 423




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147819724|emb|CAN69227.1| hypothetical protein VITISV_007111 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450019|ref|XP_002272632.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] gi|451798996|gb|AGF69196.1| disease resistance protein At3g14460-like protein 3 [Vitis labrusca] Back     alignment and taxonomy information
>gi|297736321|emb|CBI24959.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450001|ref|XP_002272075.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359497792|ref|XP_003635643.1| PREDICTED: putative disease resistance RPP13-like protein 1-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|147862409|emb|CAN81911.1| hypothetical protein VITISV_042289 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450003|ref|XP_002272221.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487172|ref|XP_002264364.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query404
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.977 0.374 0.408 3.3e-73
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.952 0.270 0.359 8.6e-53
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.935 0.209 0.275 4.5e-29
TAIR|locus:2077572 926 RPM1 "RESISTANCE TO P. SYRINGA 0.799 0.348 0.272 3e-25
TAIR|locus:504956483 847 AT3G46730 [Arabidopsis thalian 0.925 0.441 0.297 8e-23
TAIR|locus:2132741 892 AT4G10780 [Arabidopsis thalian 0.846 0.383 0.268 2.6e-21
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.858 0.390 0.267 2.5e-20
TAIR|locus:2201986 885 RFL1 "AT1G12210" [Arabidopsis 0.801 0.366 0.268 4.2e-20
TAIR|locus:2037639 907 AT1G58390 "AT1G58390" [Arabido 0.717 0.319 0.283 3e-19
TAIR|locus:2201996 889 RPS5 "AT1G12220" [Arabidopsis 0.811 0.368 0.263 5e-19
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 741 (265.9 bits), Expect = 3.3e-73, P = 3.3e-73
 Identities = 173/424 (40%), Positives = 247/424 (58%)

Query:     1 HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKY 60
             H+L+ L   DC  +F++   G  +   ++ + ++ E+IV +C G PLA KTLG +LR + 
Sbjct:   329 HNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPLAVKTLGGVLRFEG 388

Query:    61 DPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIV 120
                +WE VL+S+IWDL  D+S+++  LRVSY+YLP+++KRCFAYCS  PKG+ F++ ++V
Sbjct:   389 KVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVV 448

Query:   121 LLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKIDASRFLMHDLIHDLACWAFG 180
             LLWMAEG LQ     K +EELG + F  L SRS  Q +K   +R++MHD I++LA +A G
Sbjct:   449 LLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTK---TRYIMHDFINELAQFASG 505

Query:   181 EISSSMESTWDGNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYLRTFLALLLGTRKT 240
             E SS  E   DG  + + S   R+LSYL   +     FE L +V++LRTFL L L     
Sbjct:   506 EFSSKFE---DGC-KLQVSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSR 561

Query:   241 FYVTNNLVFH-VVPRLRQLRVVSLCGYKIVQLPNDIAE-LKHLRYLDFSHTAIEVLPES- 297
                 + +V   ++P L +LRV+SL  YKI +LP D  + + H R+LD S T +E LP+S 
Sbjct:   562 SCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSL 621

Query:   298 -----------------KLFP-DVGNLVNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKF 339
                              K  P D+ NL+NLR+L D     L +MP R G+L SL+TL  F
Sbjct:   622 CYMYNLQTLLLSYCSSLKELPTDISNLINLRYL-DLIGTKLRQMPRRFGRLKSLQTLTTF 680

Query:   340 VVGKGNCYGLKELRSLMHLQEKLTISGLENVNDAEDAKEAQLNGKEKLEALSLKWVNSTT 399
              V   +   + EL  L  L  KL I  L+ V D  DA EA LN K+ L  +   W   ++
Sbjct:   681 FVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRTGSS 740

Query:   400 SSDS 403
             SS++
Sbjct:   741 SSEN 744




GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 6e-26
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score =  105 bits (264), Expect = 6e-26
 Identities = 42/132 (31%), Positives = 68/132 (51%), Gaps = 3/132 (2%)

Query: 1   HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKY 60
           H + +L  ++   +F      +        L E+ ++IV++C G PLA K LG LL  K 
Sbjct: 151 HEVESLEPEESWELFSNKVFEKEL-PPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKS 209

Query: 61  DPKDWEDVLTSKIWDLAEDRS--SIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQ 118
             ++WE VL     +LA       ++  L +SY  LP ++KRCF Y +  P+ Y   + Q
Sbjct: 210 TVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQ 269

Query: 119 IVLLWMAEGLLQ 130
           ++ LW+AEG + 
Sbjct: 270 LIKLWIAEGFVI 281


Length = 285

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 404
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.83
KOG0617264 consensus Ras suppressor protein (contains leucine 99.36
KOG0617264 consensus Ras suppressor protein (contains leucine 99.35
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.34
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.32
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.27
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.25
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.19
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.83
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.82
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.77
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.57
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.55
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.54
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.48
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.47
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.46
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.41
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.38
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.36
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.35
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.25
PLN03150623 hypothetical protein; Provisional 98.22
PLN03150623 hypothetical protein; Provisional 98.2
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.09
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.03
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.02
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.99
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.96
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.94
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.93
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.41
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.4
PRK15386 426 type III secretion protein GogB; Provisional 97.4
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.22
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.1
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.66
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.55
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.45
PRK15386 426 type III secretion protein GogB; Provisional 96.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.99
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.96
PRK04841 903 transcriptional regulator MalT; Provisional 95.68
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.62
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.55
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.09
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.02
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.72
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.08
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.96
smart0037026 LRR Leucine-rich repeats, outliers. 91.96
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.91
KOG2982 418 consensus Uncharacterized conserved protein [Funct 90.86
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.49
smart0037026 LRR Leucine-rich repeats, outliers. 90.49
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.35
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 85.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 84.38
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 83.73
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 83.65
KOG0473 326 consensus Leucine-rich repeat protein [Function un 83.46
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 80.6
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2.3e-52  Score=426.34  Aligned_cols=382  Identities=27%  Similarity=0.405  Sum_probs=305.7

Q ss_pred             CCCCCCChhhHHHHHHHcccCCCCCCCCccHHHHHHHHHHhcCCCchhHHHHHHHhhcCCChhHHHHHHhhhhhhc----
Q 046301            1 HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDL----   76 (404)
Q Consensus         1 y~~~~L~~~~a~~Lf~~~af~~~~~~~~~~~~~l~~~i~~~c~GlPLal~~~g~~L~~~~~~~~w~~~l~~~~~~~----   76 (404)
                      ++|++|+++|||+||++.||+... ...++++++|++|+++|+|+|||+.++|+.|+.|++..+|+.+.+.+.+..    
T Consensus       312 ~~v~~L~~~eaW~LF~~~v~~~~~-~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~  390 (889)
T KOG4658|consen  312 IEVECLTPEEAWDLFQKKVGPNTL-GSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADF  390 (889)
T ss_pred             ccccccCccccHHHHHHhhccccc-cccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCC
Confidence            579999999999999999986643 344669999999999999999999999999999999999999998765542    


Q ss_pred             cccchhHHHHHHHHHhcCChhhhhhhhhcccCCCCceeChhHHHHHHHHCCCcccCCCCCcHHHHHHHHHHHHhhCCCcc
Q 046301           77 AEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRFDERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQ  156 (404)
Q Consensus        77 ~~~~~~i~~~l~~sy~~L~~~~k~cfl~~a~fp~~~~i~~~~li~~w~~~g~~~~~~~~~~~~~~~~~~~~~L~~~sli~  156 (404)
                      ....+.++.+|++|||+||++.|.||+|||.||+|++|+++.++.+|+|+||+.+..++..+++.|+.++.+|+++||+.
T Consensus       391 ~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~  470 (889)
T KOG4658|consen  391 SGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLI  470 (889)
T ss_pred             CchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHh
Confidence            22346899999999999998899999999999999999999999999999999997778889999999999999999998


Q ss_pred             ccc--CCCceEEechHHHHHHHhhhc-----CceEEcccccC--CCCccccCCCcceEEEEeccCccccccccccCCCCc
Q 046301          157 WSK--IDASRFLMHDLIHDLACWAFG-----EISSSMESTWD--GNNERRFSRNLRHLSYLTSQFDGIKRFEGLHKVEYL  227 (404)
Q Consensus       157 ~~~--~~~~~~~mhdli~~~~~~i~~-----~~~~~~~~~~~--~~~~~~~~~~~r~l~~~~~~~~~~~~~~~~~~~~~L  227 (404)
                      ..+  ....+|+|||++||||.|++.     ++.........  .......+..+|+++++.+.+...   ....+.+.|
T Consensus       471 ~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~---~~~~~~~~L  547 (889)
T KOG4658|consen  471 EERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHI---AGSSENPKL  547 (889)
T ss_pred             hcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhc---cCCCCCCcc
Confidence            755  345789999999999999999     45443332101  011222345689999988876543   344556689


Q ss_pred             cEEEecccCccccccccchhhhhhhccCccccEEEecCCC-ccccCcccccCCCcceEecCCCCcccCCCCCCCcccccc
Q 046301          228 RTFLALLLGTRKTFYVTNNLVFHVVPRLRQLRVVSLCGYK-IVQLPNDIAELKHLRYLDFSHTAIEVLPESKLFPDVGNL  306 (404)
Q Consensus       228 ~~L~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~-~~~lp~~~~~L~~L~~L~l~~~~l~~lp~~~~p~~~~~l  306 (404)
                      ++|.+..+..     ....+...+|..++.|++|||++|. +..+|..|+.|.+||||+++++.++.+|.+     +++|
T Consensus       548 ~tLll~~n~~-----~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~-----l~~L  617 (889)
T KOG4658|consen  548 RTLLLQRNSD-----WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSG-----LGNL  617 (889)
T ss_pred             ceEEEeecch-----hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchH-----HHHH
Confidence            9999987652     2455667779999999999999876 779999999999999999999999988876     9999


Q ss_pred             ccCceeecCCCCccccccccccccccccccCceEec-cCCcCCccccccccccccceEEcCCCC---C------------
Q 046301          307 VNLRHLKDSHSNLLEEMPLRIGKLTSLRTLAKFVVG-KGNCYGLKELRSLMHLQEKLTISGLEN---V------------  370 (404)
Q Consensus       307 ~~L~~L~l~~~~~l~~lp~~~~~l~~L~~L~~~~~~-~~~~~~~~~l~~L~~L~~~L~l~~~~~---~------------  370 (404)
                      ..|.+|++..+..+..+|..+..|++|++|.++... ......+.++..|.+|+ .+.++..+.   .            
T Consensus       618 k~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~-~ls~~~~s~~~~e~l~~~~~L~~~~  696 (889)
T KOG4658|consen  618 KKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLE-NLSITISSVLLLEDLLGMTRLRSLL  696 (889)
T ss_pred             HhhheeccccccccccccchhhhcccccEEEeeccccccchhhHHhhhcccchh-hheeecchhHhHhhhhhhHHHHHHh
Confidence            999999999997777776656679999999887654 22344566777777777 666644322   0            


Q ss_pred             ------CCHhHHHhccccCccCCCceEEEecCC
Q 046301          371 ------NDAEDAKEAQLNGKEKLEALSLKWVNS  397 (404)
Q Consensus       371 ------~~~~~~~~~~l~~l~~L~~L~l~~~~~  397 (404)
                            ........+.+..+.+|+.|.+..+..
T Consensus       697 ~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~  729 (889)
T KOG4658|consen  697 QSLSIEGCSKRTLISSLGSLGNLEELSILDCGI  729 (889)
T ss_pred             HhhhhcccccceeecccccccCcceEEEEcCCC
Confidence                  011133445677888899999876654



>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 6e-50
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-38
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 8e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  176 bits (448), Expect = 6e-50
 Identities = 50/311 (16%), Positives = 96/311 (30%), Gaps = 46/311 (14%)

Query: 1   HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKY 60
               +L ++  L I           +    L E    I+  C GSPL    +G+LLRD  
Sbjct: 281 PVESSLGKEKGLEILSLFV-----NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFP 335

Query: 61  D-PKDWEDVLTSKIW-----DLAEDRSSIMGALRVSYHYLPSYVKRCFAYCSFLPKGYRF 114
           +  + +   L +K +       + D  ++  A+ +S   L   +K  +   S L K  + 
Sbjct: 336 NRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKV 395

Query: 115 DERQIVLLWMAEGLLQHETYGKQMEELGRKSFQVLHSRSFFQWSKID-ASRFLMHDLIHD 173
             + + +LW  E             E      Q   ++S     +   + R+ +HDL  D
Sbjct: 396 PTKVLCILWDME------------TEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVD 443

Query: 174 LACWAFGEISSSMESTWDGNNERRFSRNLRHLSYLTSQFDG-----IKRFEGLH--KVEY 226
                         S     +++  ++  R+    T   D         F   H    + 
Sbjct: 444 FLT-------EKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKM 496

Query: 227 LRTFLALLLGTR-KTFYVTNNLVFHVVPRLRQLRVVSLCGYKIVQLPNDIAELKHLRYLD 285
            +   AL+                H++    + R        I+   +         +L 
Sbjct: 497 HKELCALMFSLDWIKAKTELVGPAHLIHEFVEYR-------HILDEKDCAVSENFQEFLS 549

Query: 286 FSHTAIEVLPE 296
            +   +   P 
Sbjct: 550 LNGHLLGRQPF 560


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query404
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.92
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.78
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.75
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.69
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.56
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.55
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.51
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.51
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.5
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.47
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.45
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.44
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.43
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.42
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.42
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.42
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.4
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.4
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.39
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.38
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.37
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.37
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.36
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.36
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.35
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.35
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.34
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.34
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.34
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.33
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.31
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.31
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.3
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.3
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.3
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.3
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.29
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.29
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.29
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.28
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.27
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.27
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.25
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.25
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.24
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.24
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.24
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.24
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.23
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.21
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.21
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.2
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.2
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.2
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.19
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.19
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.17
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.17
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.16
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.14
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.13
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.12
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.02
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.99
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.98
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.96
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.96
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.95
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.93
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.93
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.89
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.85
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.85
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.83
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.82
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.82
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.8
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.73
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.72
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.68
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.65
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.59
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.59
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.35
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.25
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.22
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.08
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.86
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.82
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.56
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.51
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.27
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.23
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.22
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.73
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.27
2fna_A357 Conserved hypothetical protein; structural genomic 95.75
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 93.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 93.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.31
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.94
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.93
4gt6_A394 Cell surface protein; leucine rich repeats, putati 90.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 89.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 84.42
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 83.96
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.92  E-value=7.3e-26  Score=225.59  Aligned_cols=172  Identities=15%  Similarity=0.177  Sum_probs=135.3

Q ss_pred             CCCCCCChhhHHHHHHHcccCCCCCCCCccHHHHHHHHHHhcCCCchhHHHHHHHhhcCCChhHHHHHHhhhhhhccccc
Q 046301            1 HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDR   80 (404)
Q Consensus         1 y~~~~L~~~~a~~Lf~~~af~~~~~~~~~~~~~l~~~i~~~c~GlPLal~~~g~~L~~~~~~~~w~~~l~~~~~~~~~~~   80 (404)
                      |+|++|+++|||+||+++||+...   ++.+++++++|+++|+|+||||+++|+.|+.+ +. .|...+....+..  ..
T Consensus       288 ~~l~~L~~~ea~~Lf~~~a~~~~~---~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~w-~~~~~l~~~l~~~--~~  360 (549)
T 2a5y_B          288 IEVTSLEIDECYDFLEAYGMPMPV---GEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TF-EKMAQLNNKLESR--GL  360 (549)
T ss_dssp             EECCCCCHHHHHHHHHHTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SH-HHHHHHHHHHHHH--CS
T ss_pred             EECCCCCHHHHHHHHHHHhcCCCC---chhHHHHHHHHHHHhCCChHHHHHHHHHhccc-hH-HHHHHhHHHhhcc--cH
Confidence            579999999999999999986542   46788999999999999999999999999876 32 2323333222211  23


Q ss_pred             hhHHHHHHHHHhcCChhhhhhhh-----------hcccCCCCceeChhHHHHHHHHC--CCcccCCCCCcHHHHHHHHHH
Q 046301           81 SSIMGALRVSYHYLPSYVKRCFA-----------YCSFLPKGYRFDERQIVLLWMAE--GLLQHETYGKQMEELGRKSFQ  147 (404)
Q Consensus        81 ~~i~~~l~~sy~~L~~~~k~cfl-----------~~a~fp~~~~i~~~~li~~w~~~--g~~~~~~~~~~~~~~~~~~~~  147 (404)
                      ..+..++++||+.||...|.||+           |||+||+++.|+    +..|+|+  |++.........++.+. +++
T Consensus       361 ~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~  435 (549)
T 2a5y_B          361 VGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLK  435 (549)
T ss_dssp             STTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHH
T ss_pred             HHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHH
Confidence            56888999999999999999999           999999999998    8899999  99987554556677777 999


Q ss_pred             HHhhCCCcccccC-CCceEEechHHHHHHHhhhcCceE
Q 046301          148 VLHSRSFFQWSKI-DASRFLMHDLIHDLACWAFGEISS  184 (404)
Q Consensus       148 ~L~~~sli~~~~~-~~~~~~mhdli~~~~~~i~~~~~~  184 (404)
                      +|+++||++.... ...+|+|||++|++|+.++.+++.
T Consensus       436 ~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          436 RLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             HTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHHH
T ss_pred             HHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHHH
Confidence            9999999998653 356799999999999999877654



>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 404
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 71.4 bits (174), Expect = 1e-14
 Identities = 14/104 (13%), Positives = 31/104 (29%), Gaps = 7/104 (6%)

Query: 1   HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKY 60
             + +L  D+C      + +        +    +  K ++  +G+P              
Sbjct: 180 IEVTSLEIDECYDFLEAYGMPMPVGEKEED---VLNKTIELSSGNPATLMMFFKSCE--- 233

Query: 61  DPKDWEDVLTSKIWDLAEDRSSIMGALRVSYHYLPSYVKRCFAY 104
            PK +E +        +     +      SY  L   ++RC   
Sbjct: 234 -PKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEV 276


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query404
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.6
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.32
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.29
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.29
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.22
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.2
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.17
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.16
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.15
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.14
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.12
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.08
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.06
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.04
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.98
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.96
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.95
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.89
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.83
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.78
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.66
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.61
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.37
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.12
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.84
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.26
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.19
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.95
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.33
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.60  E-value=5.7e-17  Score=144.78  Aligned_cols=97  Identities=12%  Similarity=0.116  Sum_probs=82.8

Q ss_pred             CCCCCCChhhHHHHHHHcccCCCCCCCCccHHHHHHHHHHhcCCCchhHHHHHHHhhcCCChhHHHHHHhhhhhhccccc
Q 046301            1 HSLRNLLRDDCLCIFVQHSLGRTDFVAHQYLSEIGEKIVDRCNGSPLAAKTLGSLLRDKYDPKDWEDVLTSKIWDLAEDR   80 (404)
Q Consensus         1 y~~~~L~~~~a~~Lf~~~af~~~~~~~~~~~~~l~~~i~~~c~GlPLal~~~g~~L~~~~~~~~w~~~l~~~~~~~~~~~   80 (404)
                      |+|++|+.+|||+||+.+||+...   .+..++++++|+++|+|+||||+++|+.|+.+ +.+.|....+.+..   ...
T Consensus       180 ~~l~~L~~~ea~~Lf~~~~~~~~~---~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~~~~~~~L~~---~~~  252 (277)
T d2a5yb3         180 IEVTSLEIDECYDFLEAYGMPMPV---GEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLES---RGL  252 (277)
T ss_dssp             EECCCCCHHHHHHHHHHTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHHHHH---HCS
T ss_pred             EECCCCCHHHHHHHHHHHhCCccC---chhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHHHHHHHHHHHhc---CcH
Confidence            679999999999999999986653   34568999999999999999999999999988 78899887776632   223


Q ss_pred             hhHHHHHHHHHhcCChhhhhhhhh
Q 046301           81 SSIMGALRVSYHYLPSYVKRCFAY  104 (404)
Q Consensus        81 ~~i~~~l~~sy~~L~~~~k~cfl~  104 (404)
                      ..+..++++||++||+++|.||-+
T Consensus       253 ~~v~~il~~sY~~L~~~lk~c~~~  276 (277)
T d2a5yb3         253 VGVECITPYSYKSLAMALQRCVEV  276 (277)
T ss_dssp             STTCCCSSSSSSSHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHhcccHHHHHHHHh
Confidence            578899999999999999999965



>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure