Citrus Sinensis ID: 046308

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
SRLGYRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGEDMHQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLTSLQSVR
ccccEEEEEEEEEccccccEEEEEEEcccccccccccccccccccccccccEEEEEEEcccccccccccEEEEEEcccccccccccccccccccccccEEEEEEEEEccccEEEEEEEEccccccEEEEEEEcccccccccEEEEEEcccccccccEEEEEEEEEEccccc
cccEEEEEEEEEccccccccEEEEEEEccccccccccccccEEEcccccccEEEEEEEccccccccccccEEEEEccEEEEEEccccccccEEEccccEEEEEEEEccccEEEEEEEEccccccccEEEEEEccHHHccccEEEEEEccccccccEEEEEEEEEccccccc
SRLGYRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISEswmnlpkgedMHQIAVELDAykndfdldgnhvaidiksvrqpvaleslnstgvdlksgrnITVRIECNGWQNLLYVNVHyadhppknvikqpinisdivpssvyvgftaatgafsesHQLLEWSLTSLQSVR
SRLGYRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGEDMHQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALeslnstgvdlksgrNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAfseshqllewsltslqsvr
SRLGYRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGEDMHQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLTSLQSVR
****YRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGEDMHQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSL*******
***GYRSIQIQLTLEMGWHLFLHLLTT***************NLPKGEDMHQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLTSLQ***
SRLGYRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGEDMHQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLTSLQSVR
SRLGYRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGEDMHQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLTS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SRLGYRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGEDMHQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLTSLQSVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q9FG33 652 Probable L-type lectin-do yes no 0.847 0.222 0.305 5e-12
Q9ZW11 623 Putative inactive L-type no no 0.602 0.165 0.346 6e-10
Q9LFH9 715 L-type lectin-domain cont no no 0.678 0.162 0.330 2e-09
Q9S9U1 686 L-type lectin-domain cont no no 0.631 0.157 0.32 3e-09
P05087272 Leucoagglutinating phytoh N/A no 0.660 0.415 0.300 8e-09
Q01806277 Lectin 1 OS=Medicago trun N/A no 0.660 0.407 0.3 8e-09
Q9LSR9 657 L-type lectin-domain cont no no 0.672 0.175 0.326 9e-09
P05046285 Lectin OS=Glycine max GN= no no 0.631 0.378 0.301 1e-08
P42088240 Lectin OS=Leucomphalos mi N/A no 0.660 0.470 0.311 1e-08
Q9FIF1 674 Probable L-type lectin-do no no 0.649 0.164 0.309 1e-08
>sp|Q9FG33|LRKS5_ARATH Probable L-type lectin-domain containing receptor kinase S.5 OS=Arabidopsis thaliana GN=LECRKS5 PE=2 SV=1 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 83/154 (53%), Gaps = 9/154 (5%)

Query: 22  LHLLTTPHQLKATAHISESWMNL-----PKGEDMHQIAVELDAYKN-DFDLDGNHVAIDI 75
           L  + TP +  A  + S  W+ +      +  +   ++VE D  K+   DLDGNHVA+++
Sbjct: 109 LAFVLTPEE-TAPQNSSGMWLGMVNERTNRNNESRIVSVEFDTRKSHSDDLDGNHVALNV 167

Query: 76  KSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKN-VIKQPINI 134
            ++   V  ESL+  G+ + SG ++T  +  +G    +YV+ +      +N V  + I++
Sbjct: 168 NNINS-VVQESLSGRGIKIDSGLDLTAHVRYDGKNLSVYVSRNLDVFEQRNLVFSRAIDL 226

Query: 135 SDIVPSSVYVGFTAATGAFSESHQLLEWSLTSLQ 168
           S  +P +VYVGFTA+T  F+E + +  WS   L+
Sbjct: 227 SAYLPETVYVGFTASTSNFTELNCVRSWSFEGLK 260

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9ZW11|LRK32_ARATH Putative inactive L-type lectin-domain containing receptor kinase III.2 OS=Arabidopsis thaliana GN=LECRK32 PE=3 SV=1 Back     alignment and function description
>sp|Q9LFH9|LRK81_ARATH L-type lectin-domain containing receptor kinase VIII.1 OS=Arabidopsis thaliana GN=LECRK81 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9U1|LRK71_ARATH L-type lectin-domain containing receptor kinase VII.1 OS=Arabidopsis thaliana GN=LECRK71 PE=2 SV=1 Back     alignment and function description
>sp|P05087|PHAL_PHAVU Leucoagglutinating phytohemagglutinin OS=Phaseolus vulgaris GN=DLEC2 PE=1 SV=1 Back     alignment and function description
>sp|Q01806|LEC1_MEDTR Lectin 1 OS=Medicago truncatula GN=LEC1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LSR9|LRK18_ARATH L-type lectin-domain containing receptor kinase I.8 OS=Arabidopsis thaliana GN=LECRK18 PE=2 SV=1 Back     alignment and function description
>sp|P05046|LEC_SOYBN Lectin OS=Glycine max GN=LE1 PE=1 SV=1 Back     alignment and function description
>sp|P42088|LEC_LEUMI Lectin OS=Leucomphalos mildbraedii PE=1 SV=1 Back     alignment and function description
>sp|Q9FIF1|LRK21_ARATH Probable L-type lectin-domain containing receptor kinase II.1 OS=Arabidopsis thaliana GN=LECRK21 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
296082025 569 unnamed protein product [Vitis vinifera] 0.953 0.286 0.485 4e-37
359476128 661 PREDICTED: probable L-type lectin-domain 0.713 0.184 0.508 1e-30
255548946 584 conserved hypothetical protein [Ricinus 0.684 0.200 0.504 5e-26
11596188268 lectin-related protein precursor [Citrus 0.684 0.436 0.451 3e-17
242054595 680 hypothetical protein SORBIDRAFT_03g03637 0.643 0.161 0.355 1e-11
357131095 615 PREDICTED: L-type lectin-domain containi 0.678 0.188 0.363 2e-11
326497031 671 predicted protein [Hordeum vulgare subsp 0.643 0.163 0.347 3e-11
297822473 649 predicted protein [Arabidopsis lyrata su 0.672 0.177 0.364 4e-11
413952253 705 putative lectin-domain receptor-like pro 0.643 0.156 0.338 6e-11
219885455 679 unknown [Zea mays] gi|413952252|gb|AFW84 0.643 0.162 0.338 7e-11
>gi|296082025|emb|CBI21030.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 109/167 (65%), Gaps = 4/167 (2%)

Query: 1   SRLGYRSIQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGEDMHQIAVELDAY 60
           S+LG     IQL L M W L  H +  P QL A A   ESW     G  + Q+AVELD Y
Sbjct: 105 SQLGSPPSPIQLGLAMEWPLSWHRIANPPQLVALARFLESW----TGGVVRQLAVELDTY 160

Query: 61  KNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYA 120
            N+FD D NH+ ID  S+  P+A +SL+ TGVDLKSGR + V+I+ +GW+  L+++V YA
Sbjct: 161 MNEFDPDANHIGIDTTSIAIPIAAKSLSGTGVDLKSGREVKVKIDYDGWRETLHISVGYA 220

Query: 121 DHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLTSL 167
            +P  + +   I +SD VPSSVYVGFT +TG  SE+HQ+L+W+ TS+
Sbjct: 221 GNPLLSFLNHSIALSDTVPSSVYVGFTGSTGTVSETHQVLDWAFTSI 267

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359476128|ref|XP_002282629.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548946|ref|XP_002515529.1| conserved hypothetical protein [Ricinus communis] gi|223545473|gb|EEF46978.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|11596188|gb|AAG38522.1|AF283537_1 lectin-related protein precursor [Citrus x paradisi] Back     alignment and taxonomy information
>gi|242054595|ref|XP_002456443.1| hypothetical protein SORBIDRAFT_03g036370 [Sorghum bicolor] gi|241928418|gb|EES01563.1| hypothetical protein SORBIDRAFT_03g036370 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357131095|ref|XP_003567178.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326497031|dbj|BAK02100.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|297822473|ref|XP_002879119.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324958|gb|EFH55378.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|413952253|gb|AFW84902.1| putative lectin-domain receptor-like protein kinase family protein [Zea mays] Back     alignment and taxonomy information
>gi|219885455|gb|ACL53102.1| unknown [Zea mays] gi|413952252|gb|AFW84901.1| putative lectin-domain receptor-like protein kinase family protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
TAIR|locus:2170224 652 AT5G06740 [Arabidopsis thalian 0.842 0.220 0.309 8.2e-14
TAIR|locus:2025037258 AT1G07460 [Arabidopsis thalian 0.660 0.437 0.370 3.2e-12
TAIR|locus:2083986 715 AT3G53380 [Arabidopsis thalian 0.707 0.169 0.328 1e-11
TAIR|locus:2143528 711 AT5G03140 [Arabidopsis thalian 0.660 0.158 0.333 4.5e-11
TAIR|locus:2138381 686 AT4G04960 [Arabidopsis thalian 0.678 0.169 0.336 7e-11
UNIPROTKB|B3EWJ2 237 B3EWJ2 "Lectin alpha chain" [D 0.625 0.451 0.327 2.2e-10
UNIPROTKB|P08902 237 P08902 "Lectin alpha chain" [D 0.625 0.451 0.327 2.2e-10
TAIR|locus:2144025 657 AT5G60280 [Arabidopsis thalian 0.684 0.178 0.330 2.3e-10
UNIPROTKB|P42088240 P42088 "Lectin" [Leucomphalos 0.660 0.470 0.311 2.3e-10
UNIPROTKB|P58908 237 P58908 "Lectin alpha chain" [D 0.625 0.451 0.327 2.9e-10
TAIR|locus:2170224 AT5G06740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 8.2e-14, P = 8.2e-14
 Identities = 48/155 (30%), Positives = 87/155 (56%)

Query:    22 LHLLTTPHQLKATAHISESWMNLP-----KGEDMHQIAVELDAYKNDFD-LDGNHVAIDI 75
             L  + TP +  A  + S  W+ +      +  +   ++VE D  K+  D LDGNHVA+++
Sbjct:   109 LAFVLTPEET-APQNSSGMWLGMVNERTNRNNESRIVSVEFDTRKSHSDDLDGNHVALNV 167

Query:    76 KSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQNL-LYVNVHYADHPPKNVI-KQPIN 133
              ++   V  ESL+  G+ + SG ++T  +  +G +NL +YV+ +      +N++  + I+
Sbjct:   168 NNINS-VVQESLSGRGIKIDSGLDLTAHVRYDG-KNLSVYVSRNLDVFEQRNLVFSRAID 225

Query:   134 ISDIVPSSVYVGFTAATGAFSESHQLLEWSLTSLQ 168
             +S  +P +VYVGFTA+T  F+E + +  WS   L+
Sbjct:   226 LSAYLPETVYVGFTASTSNFTELNCVRSWSFEGLK 260
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=ISS
GO:0000041 "transition metal ion transport" evidence=RCA
TAIR|locus:2025037 AT1G07460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083986 AT3G53380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138381 AT4G04960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B3EWJ2 B3EWJ2 "Lectin alpha chain" [Dioclea sclerocarpa (taxid:1176036)] Back     alignment and assigned GO terms
UNIPROTKB|P08902 P08902 "Lectin alpha chain" [Dioclea grandiflora (taxid:3837)] Back     alignment and assigned GO terms
TAIR|locus:2144025 AT5G60280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P42088 P42088 "Lectin" [Leucomphalos mildbraedii (taxid:28956)] Back     alignment and assigned GO terms
UNIPROTKB|P58908 P58908 "Lectin alpha chain" [Dioclea rostrata (taxid:192416)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 6e-33
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 1e-31
cd01951223 cd01951, lectin_L-type, legume lectins 1e-21
>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information 
 Score =  116 bits (293), Expect = 6e-33
 Identities = 46/117 (39%), Positives = 71/117 (60%), Gaps = 3/117 (2%)

Query: 51  HQIAVELDAYKNDF--DLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNG 108
           H +AVE D + N    D+D NHV ID+ S+   VA ES +   +DL SG+ I V I+ +G
Sbjct: 116 HIVAVEFDTFLNPEFNDIDDNHVGIDVNSII-SVASESASFVPLDLNSGKPIQVWIDYDG 174

Query: 109 WQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLT 165
               L V + Y + P + ++   +++S ++P  VYVGF+A+TG  +ESH +L WS +
Sbjct: 175 SSKRLSVTLAYPNKPKRPLLSASVDLSTVLPEWVYVGFSASTGGATESHYVLSWSFS 231

Length = 231
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 100.0
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 100.0
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 100.0
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 99.7
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 99.5
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 99.14
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 99.02
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 98.82
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 98.36
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 98.26
KOG3839351 consensus Lectin VIP36, involved in the transport 97.85
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
Probab=100.00  E-value=2.9e-43  Score=287.96  Aligned_cols=148  Identities=32%  Similarity=0.586  Sum_probs=130.8

Q ss_pred             CCCCeEEEEEECCCCCCCCCCCCCCcccCCCCC-----CCcEEEEEEeCCCC-CC-CCCCCeEEEecCCCcccccccccC
Q 046308           16 MGWHLFLHLLTTPHQLKATAHISESWMNLPKGE-----DMHQIAVELDAYKN-DF-DLDGNHVAIDIKSVRQPVALESLN   88 (171)
Q Consensus        16 ~ggDG~AFvl~~~~~~~~~~~~~G~~LGl~~~~-----~~~~vAVEFDT~~n-~~-Dp~~nHVgIdins~~~S~~t~~~~   88 (171)
                      .+||||||||+++ ... +++..|++|||.+..     .++.|||||||++| ++ ||+.|||||++|++. |..+..+.
T Consensus        78 ~~gdGlAF~i~~~-~~~-~~~~~G~~lG~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~-S~~~~~~~  154 (236)
T cd06899          78 LGGDGLAFFLAPT-DSL-PPASSGGYLGLFNSSNNGNSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLV-SVKAGYWD  154 (236)
T ss_pred             CCCCeEEEEEecC-CCC-CCCCCcceeeeecCCCCCCcccceEEEEeecccCcccCCCCCCeEEEEcCCcc-cceeeccc
Confidence            5799999999954 332 337899999998743     34899999999999 66 999999999999998 88887776


Q ss_pred             CCccccCCCceEEEEEEEcCCcCeEEEEEEeCC--CCCceeeEEeeecCCCCCCeEEEEEecccCCcccceEEEEEEEee
Q 046308           89 STGVDLKSGRNITVRIECNGWQNLLYVNVHYAD--HPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLTS  166 (171)
Q Consensus        89 ~~~~~l~~G~~~~a~I~Yd~~~~~L~V~l~~~~--~~~~p~ls~~vdL~~~l~~~v~VGFSAsTG~~~~~h~IlsWsF~s  166 (171)
                      .....|.+|+.++|||+||+.+++|+|+|....  +|..|+|+..+||+.+|+++|||||||+||...|.|+|++|+|++
T Consensus       155 ~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s  234 (236)
T cd06899         155 DDGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSS  234 (236)
T ss_pred             cccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEc
Confidence            545668999999999999999999999999854  788999999999999999999999999999999999999999987

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
1fat_A252 Phytohemagglutinin-L Length = 252 8e-10
1g8w_A233 Improved Structure Of Phytohemagglutinin-L From The 9e-10
2sba_A253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 1e-09
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 2e-09
3usu_A256 Crystal Structure Of Butea Monosperma Seed Lectin L 2e-09
3usu_B242 Crystal Structure Of Butea Monosperma Seed Lectin L 3e-09
2fmd_A240 Structural Basis Of Carbohydrate Recognition By Bow 3e-09
3ujo_A281 Galactose-Specific Seed Lectin From Dolichos Lablab 4e-09
2je9_A 239 Crystal Structure Of Recombinant Dioclea Grandiflor 6e-09
2jec_A 239 Crystal Structure Of Recombinant Dioclea Grandiflor 6e-09
2gdf_A 237 Crystal Structure Of Dioclea Violacea Seed Lectin L 7e-09
3sh3_A 237 Crystal Structure Of A Pro-Inflammatory Lectin From 7e-09
2zbj_A 237 Crystal Structure Of Dioclea Rostrata Lectin Length 1e-08
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 2e-08
1dgl_A 237 Lectin From Dioclea Grandiflora Complexed To Triman 3e-08
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 4e-08
1cn1_A 237 Crystal Structure Of Demetallized Concanavalin A. T 4e-08
2cna_A 237 The Covalent And Three-Dimensional Structure Of Con 4e-08
3a0k_A 237 Crystal Structure Of An Antiflamatory Legume Lectin 4e-08
3ipv_B239 Crystal Structure Of Spatholobus Parviflorus Seed L 4e-08
2ovu_A 237 Crystal Strucure Of A Lectin From Canavalia Gladiat 5e-08
1mvq_A 236 Cratylia Mollis Lectin (Isoform 1) In Complex With 6e-08
3rrd_A 237 Native Structure Of Dioclea Virgata Lectin Length = 6e-08
2je7_A 239 Crystal Structure Of Recombinant Dioclea Guianensis 7e-08
2jdz_A 239 Crystal Structure Of Recombinant Dioclea Guianensis 8e-08
3ipv_A251 Crystal Structure Of Spatholobus Parviflorus Seed L 8e-08
1wuv_A 237 Crystal Structure Of Native Canavalia Gladiata Lect 8e-08
1h9p_A 237 Crystal Structure Of Dioclea Guianensis Seed Lectin 1e-07
1h9w_A 237 Native Dioclea Guianensis Seed Lectin Length = 237 1e-07
3u4x_A 236 Crystal Structure Of A Lectin From Camptosema Pedic 1e-07
2d3p_A 236 Cratylia Floribunda Seed Lectin Crystallized At Bas 2e-07
2yz4_A 237 The Neutron Structure Of Concanavalin A At 2.2 Angs 2e-07
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 2e-07
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 2e-07
2ctv_A 237 High Resolution Crystallographic Studies Of Native 2e-07
1azd_A 237 Concanavalin From Canavalia Brasiliensis Length = 2 2e-07
2ow4_A 237 Crystal Structure Of A Lectin From Canavalia Mariti 3e-07
2cwm_A 237 Native Crystal Structure Of No Releasing Inductive 3e-07
1qmo_E133 Structure Of Fril, A Legume Lectin That Delays Hema 4e-07
1qnw_A242 Lectin Ii From Ulex Europaeus Length = 242 5e-07
1n47_A233 Isolectin B4 From Vicia Villosa In Complex With The 6e-07
2e7q_A237 Crystal Structure Of Basic Winged Bean Lectin In Co 9e-07
1wbf_A242 Winged Bean Lectin, Saccharide Free Form Length = 2 9e-07
1wbl_A241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 1e-06
1avb_A226 Arcelin-1 From Phaseolus Vulgaris L Length = 226 1e-06
3zvx_A261 Structure Of The Lectin From Platypodium Elegans In 4e-06
1gz9_A239 High-Resolution Crystal Structure Of Erythrina Cris 5e-06
1lte_A239 Structure Of A Legume Lectin With An Ordered N-Link 1e-05
1sfy_A239 Crystal Structure Of Recombinant Erythrina Corallod 2e-05
1uzy_A242 Erythrina Crystagalli Lectin Length = 242 3e-05
1ax0_A239 Erythrina Corallodendron Lectin In Complex With N-A 4e-05
3n35_A242 Erythrina Corallodendron Lectin Mutant (Y106g) With 4e-05
1fyu_A255 Crystal Structure Of Erythrina Corallodendron Lecti 4e-05
1dbn_A239 Maackia Amurensis Leukoagglutinin (Lectin) With Sia 1e-04
1fny_A237 Legume Lectin Of The Bark Of Robinia Pseudoacacia. 2e-04
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure 
Iteration: 1

 Score = 59.7 bits (143), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 10/122 (8%)
Query: 49  DMHQIAVELDA-YKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECN 107
           + H +AVE D  Y  D+D    H+ ID+ S+R      S+ +T  D  +G N  V I  +
Sbjct: 115 NFHTVAVEFDTLYNKDWDPTERHIGIDVNSIR------SIKTTRWDFVNGENAEVLITYD 168
Query: 108 GWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATG---AFSESHQLLEWSL 164
              NLL  ++ Y       ++   +++  ++P  V VGF+A TG      E++ +L WS 
Sbjct: 169 SSTNLLVASLVYPSQKTSFIVSDTVDLKSVLPEWVSVGFSATTGINKGNVETNDVLSWSF 228
Query: 165 TS 166
            S
Sbjct: 229 AS 230
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure
>pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 Back     alignment and structure
>pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 Back     alignment and structure
>pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 Back     alignment and structure
>pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 Back     alignment and structure
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|1AVB|A Chain A, Arcelin-1 From Phaseolus Vulgaris L Length = 226 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 Back     alignment and structure
>pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 Back     alignment and structure
>pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 Back     alignment and structure
>pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 Back     alignment and structure
>pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 Back     alignment and structure
>pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 Back     alignment and structure
>pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 Back     alignment and structure
>pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 Back     alignment and structure
>pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 3e-24
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 1e-23
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 2e-23
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 2e-23
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 3e-23
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 6e-23
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 6e-23
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 8e-23
1nls_A 237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 1e-22
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 5e-22
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 7e-22
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 7e-22
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 2e-21
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 5e-21
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 6e-21
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 6e-21
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 7e-21
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 7e-21
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 2e-19
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 2e-19
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 3e-19
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 5e-18
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 4e-17
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 2e-16
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 2e-09
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 3e-09
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 1e-08
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 5e-07
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
 Score = 93.7 bits (232), Expect = 3e-24
 Identities = 30/119 (25%), Positives = 50/119 (42%), Gaps = 9/119 (7%)

Query: 51  HQIAVELDAYKNDFDLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGWQ 110
             +AVE D Y N +D +  H+ ID   +       S  +T  D+  G    + I      
Sbjct: 118 QTVAVEFDTYSNAWDPNYTHIGIDTNGIE------SKKTTPFDMVYGEKANIVITYQAST 171

Query: 111 NLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATG---AFSESHQLLEWSLTS 166
             L  ++ +        +   +++ DI+P  V VGF+A TG      E+H ++ WS   
Sbjct: 172 KALAASLVFPVSQTSYAVSARVDLRDILPEYVRVGFSATTGLNAGVVETHDIVSWSFAV 230
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 100.0
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 100.0
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 100.0
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 100.0
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 100.0
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 100.0
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 100.0
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 100.0
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 100.0
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 100.0
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 100.0
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 100.0
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 100.0
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 100.0
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 100.0
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 100.0
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 100.0
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 100.0
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 100.0
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 100.0
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 100.0
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 100.0
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 100.0
1nls_A 237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 100.0
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 100.0
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 99.97
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.95
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.95
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.84
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.65
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 99.55
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 98.85
1qmo_A113 Mannose binding lectin, FRIL; crosslink, hematopoi 98.17
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
Probab=100.00  E-value=2.8e-48  Score=320.61  Aligned_cols=146  Identities=23%  Similarity=0.397  Sum_probs=131.6

Q ss_pred             CCCCeEEEEEECCCCCCCCCCCCCCcccCCCCC------CCcEEEEEEeCC---CC-CCCCCCCeEEEecCCCccccccc
Q 046308           16 MGWHLFLHLLTTPHQLKATAHISESWMNLPKGE------DMHQIAVELDAY---KN-DFDLDGNHVAIDIKSVRQPVALE   85 (171)
Q Consensus        16 ~ggDG~AFvl~~~~~~~~~~~~~G~~LGl~~~~------~~~~vAVEFDT~---~n-~~Dp~~nHVgIdins~~~S~~t~   85 (171)
                      .+||||||||+ |.+..+|.+++|+||||++.+      .++.|||||||+   +| +|||++||||||+|++. |.+++
T Consensus        92 ~~gdGlAF~la-p~~~~~p~~~~g~~LGL~n~~~~g~~~~n~~vAVEFDT~~~~~n~~~Dp~~nHVGIdvNsi~-S~~s~  169 (261)
T 3zyr_A           92 NPADGIAFFIA-PPDTTIPSGSAGGLLGLFNPRTALNESANQVLAVEFDTFFAQNSNTWDPNYQHIGIDVNSIR-SSKVV  169 (261)
T ss_dssp             SCCCEEEEEEE-CTTCCCCTTCCGGGTTTCCTTTTTCGGGCCCEEEEEECCCCTTTCTTSCSSCEEEEEESSSS-CSEEE
T ss_pred             CCCccEEEEEc-cCCCCCCCCCCCceeeeecccccCCCccCcEEEEEEeccccccCcCCCCCCCeEEEEcCCCC-ccccc
Confidence            58999999999 445556788999999999732      248999999999   99 89999999999999999 99998


Q ss_pred             ccCCCccccCCCceEEEEEEEcCCcCeEEEEEEeCCCCCceeeEEeeecCCCCCCeEEEEEecccCCcccceEEEEEEEe
Q 046308           86 SLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAFSESHQLLEWSLT  165 (171)
Q Consensus        86 ~~~~~~~~l~~G~~~~a~I~Yd~~~~~L~V~l~~~~~~~~p~ls~~vdL~~~l~~~v~VGFSAsTG~~~~~h~IlsWsF~  165 (171)
                      +|     .+.+|+.++|||+||+.+++|+|+|.+.. ++.|+|+..+||+++|+|+|||||||+||...|.|+|++|+|+
T Consensus       170 ~~-----~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~-~~~~~ls~~vdL~~~l~e~v~VGFSAsTG~~~e~h~IlsWsF~  243 (261)
T 3zyr_A          170 RW-----ERREGKTLNVLVTYNPSTRTIDVVATYPD-GQRYQLSHVVDLTTILPEWVRVGFSAASGEQFQTHNLESWSFT  243 (261)
T ss_dssp             EC-----CCCTTCCEEEEEEEETTTTEEEEEEECTT-CCEEEEEEECCGGGTSCSEEEEEEEEEESSSCCEEEEEEEEEE
T ss_pred             cc-----cccCCceEEEEEEEcCCCCEEEEEEEcCC-CCCeEEEEEechHHhCcCcEEEEEEecCCCccceEEEEEEEEE
Confidence            87     36799999999999999999999999854 3489999999999999999999999999999999999999999


Q ss_pred             e-ccc
Q 046308          166 S-LQS  169 (171)
Q Consensus       166 s-l~~  169 (171)
                      + |+.
T Consensus       244 s~l~~  248 (261)
T 3zyr_A          244 STLLY  248 (261)
T ss_dssp             EEECC
T ss_pred             EEcCC
Confidence            9 874
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure
>1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 1e-28
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 2e-28
d1nlsa_ 237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 2e-28
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 4e-28
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 2e-26
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 5e-25
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 1e-24
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 1e-24
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 2e-24
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 2e-24
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 5e-24
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 1e-23
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 3e-23
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 4e-23
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 1e-21
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 2e-21
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 7e-21
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 2e-20
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 4e-20
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 7e-20
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 2e-18
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 1e-14
d2a6va1218 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake 3e-08
d2a6za1221 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake 2e-04
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]

 Score =  103 bits (259), Expect = 1e-28
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 10/120 (8%)

Query: 51  HQIAVELDAYKNDF-DLDGNHVAIDIKSVRQPVALESLNSTGVDLKSGRNITVRIECNGW 109
             +AVE D + N +      H+ ID+ S+R      S+ +    L +G+   V I+ +  
Sbjct: 122 QTLAVEFDTFSNPWDPPQVPHIGIDVNSIR------SIKTQPFQLDNGQVANVVIKYDAP 175

Query: 110 QNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGA---FSESHQLLEWSLTS 166
             +L+V + Y        I + +++  ++P  V VG + ATGA    +E+H +  WS  +
Sbjct: 176 SKILHVVLVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVYSWSFQA 235
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 100.0
d1leda_243 Legume lectin {West-central african legume (Griffo 100.0
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 100.0
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 100.0
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 100.0
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 100.0
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 100.0
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 100.0
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 100.0
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 100.0
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 100.0
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 100.0
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 100.0
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 100.0
d1nlsa_ 237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 100.0
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.97
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.89
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 99.67
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 99.67
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]

Probab=100.00  E-value=2e-45  Score=297.85  Aligned_cols=153  Identities=24%  Similarity=0.405  Sum_probs=131.3

Q ss_pred             EEEEEeecCCCCeEEEEEECCCCCCCCCCCCCCcccCCCCC------CCcEEEEEEeCCCC-CC-CCCCCeEEEecCCCc
Q 046308            8 IQIQLTLEMGWHLFLHLLTTPHQLKATAHISESWMNLPKGE------DMHQIAVELDAYKN-DF-DLDGNHVAIDIKSVR   79 (171)
Q Consensus         8 ~~~~~~~~~ggDG~AFvl~~~~~~~~~~~~~G~~LGl~~~~------~~~~vAVEFDT~~n-~~-Dp~~nHVgIdins~~   79 (171)
                      |+|......+||||||||+++ ..  +++..|++||+++..      .++.|||||||++| ++ ||++||||||+|++.
T Consensus        74 F~i~~~~~~~gDGlAFvl~p~-~~--~~~~~G~~lGl~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHIgIdvns~~  150 (236)
T d1hqla_          74 FFLKITGNGPADGLAFFLAPP-DS--DVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIV  150 (236)
T ss_dssp             EEEEECSSCCCCEEEEEEECT-TC--CCCCCGGGTTTSCTTTTTCGGGCCCEEEEEECSCCSSSCCCSSCEEEEEESSSS
T ss_pred             EEEeCCCCCCCceEEEEEeCC-CC--CCCCCccccccccccccCCcccCceEEEEeeCccCCCCCCCCCCEEEEEcCCcc
Confidence            344444446799999999954 43  447899999998732      24789999999999 65 999999999999999


Q ss_pred             ccccccccCCCccccCCCceEEEEEEEcCCcCeEEEEEEeCCCCCceeeEEeeecCCCCCCeEEEEEecccCCc-ccceE
Q 046308           80 QPVALESLNSTGVDLKSGRNITVRIECNGWQNLLYVNVHYADHPPKNVIKQPINISDIVPSSVYVGFTAATGAF-SESHQ  158 (171)
Q Consensus        80 ~S~~t~~~~~~~~~l~~G~~~~a~I~Yd~~~~~L~V~l~~~~~~~~p~ls~~vdL~~~l~~~v~VGFSAsTG~~-~~~h~  158 (171)
                       |..+.++.  ..++++|+.++|||+||+.+++|+|+|+.. +++.|+|++.+||+++|+++||||||||||.. .+.|+
T Consensus       151 -s~~~~~~~--~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~-~~~~~~ls~~vdL~~~l~~~v~vGFSasTG~~~~~~h~  226 (236)
T d1hqla_         151 -SVATKRWE--DSDIFSGKIATARISYDGSAEILTVVLSYP-DGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVY  226 (236)
T ss_dssp             -CSEEEECC--HHHHTSCSCEEEEEEEETTTTEEEEEEEET-TTEEEEEEEECCGGGTSCSEEEEEEEEECCSCCCEEEE
T ss_pred             -cccccccc--cccccCCCEEEEEEEEeCCCcEEEEEEecC-CCCCeeEEEEeCHHHhCCCcEEEEEEeECCCCCceEEE
Confidence             88887774  467899999999999999999999999874 56789999999999999999999999999975 67799


Q ss_pred             EEEEEEee-c
Q 046308          159 LLEWSLTS-L  167 (171)
Q Consensus       159 IlsWsF~s-l  167 (171)
                      |++|+|++ |
T Consensus       227 I~sWsF~s~l  236 (236)
T d1hqla_         227 ILSWRFSSNL  236 (236)
T ss_dssp             EEEEEEEEEC
T ss_pred             EEEeEeEecC
Confidence            99999998 6
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure