Citrus Sinensis ID: 046448

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MEKAASLKLTLLVAVLFCFVNSTKSTGVPHGNKVNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLLSY
cHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccccccEEEEEEEEEcccccEEEEEEEEcccccccEEEEEccccccccccccccccccccccccccccccccccccccEEEcccccEEEEEEEEcEEEEcccccccEEEEEEccccccccccccccccccccccccEEEEEEEEEcc
cHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEcccccEEEEEEEEccccccEEEEEEEEccccEEEEEEEEcccccccHHHHHccEcccccccccccccccccccEEEEEEEcccccEEEEEEEEccccccccccccccEEEEEcccccccccccccHHHHcccccEEEEEEcEEccc
MEKAASLKLTLLVAVLFCFvnstkstgvphgnkvNAIAVItgreggpkgsifffqdgdhgptilngylhglppghhgfhvhaagdtrhecnsagshfnphnmlhgskedehrhagdlGNLIVDVYGNAylshfldnkirltgphsiiGRAIVIhkdqddfgrgghndskstghageriACGVIGLLSY
MEKAASLKLTLLVAVLFCFVNstkstgvphgnkVNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGghndskstghageriacgvigllsy
MEKAASLKLTLLVAVLFCFVNSTKSTGVPHGNKVNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYlhglppghhgFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLLSY
******LKLTLLVAVLFCFVNSTKSTGVPHGNKVNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAG******************************GDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKD********************RIACGVIGLL**
*****SLKLTLLVAVLFCFVN************VNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLLSY
MEKAASLKLTLLVAVLFCFVNSTKSTGVPHGNKVNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLLSY
MEKAASLKLTLLVAVLFCFVNSTKSTGVPHGNKVNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLLSY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKAASLKLTLLVAVLFCFVNSTKSTGVPHGNKVNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLLSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query188 2.2.26 [Sep-21-2011]
P23345152 Superoxide dismutase [Cu- N/A no 0.792 0.980 0.578 3e-41
P23346152 Superoxide dismutase [Cu- N/A no 0.792 0.980 0.578 5e-41
Q7M1R5152 Superoxide dismutase [Cu- yes no 0.792 0.980 0.585 5e-41
Q8L5E0152 Superoxide dismutase [Cu- N/A no 0.792 0.980 0.578 7e-41
P27082152 Superoxide dismutase [Cu- N/A no 0.792 0.980 0.565 3e-40
Q43779152 Superoxide dismutase [Cu- N/A no 0.792 0.980 0.578 4e-40
P28757152 Superoxide dismutase [Cu- yes no 0.792 0.980 0.572 4e-40
O04996153 Superoxide dismutase [Cu- N/A no 0.797 0.980 0.552 4e-40
O65768152 Superoxide dismutase [Cu- N/A no 0.792 0.980 0.572 5e-40
P11428151 Superoxide dismutase [Cu- N/A no 0.787 0.980 0.572 8e-40
>sp|P23345|SODC4_MAIZE Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SODCC.3 PE=2 SV=2 Back     alignment and function desciption
 Score =  167 bits (423), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/152 (57%), Positives = 111/152 (73%), Gaps = 3/152 (1%)

Query: 34  VNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSA 93
           V A+AV+   EG  KG+IFF Q+GD GPT + G + GL PG HGFHVHA GDT + C S 
Sbjct: 2   VKAVAVLGSSEG-VKGTIFFTQEGD-GPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMST 59

Query: 94  GSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVI 153
           G H+NP +  HG+ EDE+RHAGDLGN+     G A + +  D++I LTGP+SIIGRA+V+
Sbjct: 60  GPHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANI-NVTDSQIPLTGPNSIIGRAVVV 118

Query: 154 HKDQDDFGRGGHNDSKSTGHAGERIACGVIGL 185
           H D DD G+GGH  SKSTG+AG R+ACG+IGL
Sbjct: 119 HADPDDLGKGGHELSKSTGNAGGRVACGIIGL 150
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Zea mays (taxid: 4577)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|P23346|SODC5_MAIZE Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SODCC.2 PE=2 SV=2 Back     alignment and function description
>sp|Q7M1R5|SODC_SOYBN Superoxide dismutase [Cu-Zn] OS=Glycine max GN=SOD1 PE=3 SV=1 Back     alignment and function description
>sp|Q8L5E0|ALL5B_OLEEU Superoxide dismutase [Cu-Zn] 2 OS=Olea europaea GN=OLE5 PE=1 SV=2 Back     alignment and function description
>sp|P27082|SODC_NICPL Superoxide dismutase [Cu-Zn] OS=Nicotiana plumbaginifolia GN=SODCC PE=2 SV=2 Back     alignment and function description
>sp|Q43779|SODC2_SOLLC Superoxide dismutase [Cu-Zn] 2 OS=Solanum lycopersicum GN=SODCC.5 PE=3 SV=3 Back     alignment and function description
>sp|P28757|SODC2_ORYSJ Superoxide dismutase [Cu-Zn] 2 OS=Oryza sativa subsp. japonica GN=SODCC2 PE=1 SV=2 Back     alignment and function description
>sp|O04996|SODC_SOLCS Superoxide dismutase [Cu-Zn] OS=Solidago canadensis var. scabra GN=SODCC PE=2 SV=3 Back     alignment and function description
>sp|O65768|SODC_CARPA Superoxide dismutase [Cu-Zn] OS=Carica papaya GN=SODCC PE=2 SV=1 Back     alignment and function description
>sp|P11428|SODC2_MAIZE Superoxide dismutase [Cu-Zn] 2 OS=Zea mays GN=SODCC.1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
306755374152 csd1 [Pleioblastus fortunei] 0.792 0.980 0.598 4e-41
357121554152 PREDICTED: superoxide dismutase [Cu-Zn] 0.792 0.980 0.598 8e-41
13274150152 putative cytosolic CuZn-superoxide dismu 0.792 0.980 0.605 2e-40
224125448152 predicted protein [Populus trichocarpa] 0.792 0.980 0.598 3e-40
326415941152 Cu/Zn superoxide dismutase [Vigna radiat 0.792 0.980 0.592 4e-40
427199298152 CuZn superoxide dismutase [Ipomoea batat 0.792 0.980 0.592 5e-40
118482799152 unknown [Populus trichocarpa] 0.792 0.980 0.592 5e-40
19172405152 copper/zinc superoxide dismutase [Sander 0.792 0.980 0.592 5e-40
261746204152 copper/zinc-superoxide dismutase [Bambus 0.792 0.980 0.578 6e-40
257781222152 Cu/Zn superoxide dismutase [Deschampsia 0.792 0.980 0.592 7e-40
>gi|306755374|gb|ADN04915.1| csd1 [Pleioblastus fortunei] Back     alignment and taxonomy information
 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 91/152 (59%), Positives = 112/152 (73%), Gaps = 3/152 (1%)

Query: 34  VNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSA 93
           V A+AV+T  EG  KG+IFF Q+GD GPT + G + GL PG HGFHVHA GDT + C S 
Sbjct: 2   VKAVAVLTSSEG-VKGTIFFSQEGD-GPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMST 59

Query: 94  GSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVI 153
           G HFNP    HG+ EDE+RHAGDLGN+     G A + + +D++I LTGPHSIIGRA+V+
Sbjct: 60  GPHFNPAGKEHGAPEDENRHAGDLGNVTAGADGVANV-NVVDSQIPLTGPHSIIGRAVVV 118

Query: 154 HKDQDDFGRGGHNDSKSTGHAGERIACGVIGL 185
           H D DD G+GGH  SKSTG+AG R+ACG+IGL
Sbjct: 119 HADPDDLGKGGHELSKSTGNAGGRVACGIIGL 150

Source: Pleioblastus fortunei

Species: Pleioblastus fortunei

Genus: Pleioblastus

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357121554|ref|XP_003562484.1| PREDICTED: superoxide dismutase [Cu-Zn] 4A-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|13274150|emb|CAC33845.1| putative cytosolic CuZn-superoxide dismutase [Populus tremula x Populus tremuloides] gi|52313438|dbj|BAD51399.1| CuZn-superoxide dismutase [Populus alba x Populus tremula var. glandulosa] gi|52313440|dbj|BAD51400.1| CuZn-superoxide dismutase [Populus alba x Populus tremula var. glandulosa] Back     alignment and taxonomy information
>gi|224125448|ref|XP_002319589.1| predicted protein [Populus trichocarpa] gi|118488274|gb|ABK95956.1| unknown [Populus trichocarpa] gi|222857965|gb|EEE95512.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|326415941|gb|ADZ72850.1| Cu/Zn superoxide dismutase [Vigna radiata] gi|326415943|gb|ADZ72851.1| Cu/Zn superoxide dismutase [Vigna radiata] Back     alignment and taxonomy information
>gi|427199298|gb|AFY26880.1| CuZn superoxide dismutase [Ipomoea batatas] Back     alignment and taxonomy information
>gi|118482799|gb|ABK93317.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|19172405|gb|AAL85888.1|AF479059_1 copper/zinc superoxide dismutase [Sandersonia aurantiaca] Back     alignment and taxonomy information
>gi|261746204|gb|ACX94084.1| copper/zinc-superoxide dismutase [Bambusa oldhamii] Back     alignment and taxonomy information
>gi|257781222|gb|ACV65038.1| Cu/Zn superoxide dismutase [Deschampsia antarctica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
UNIPROTKB|P28757152 SODCC2 "Superoxide dismutase [ 0.792 0.980 0.532 1.1e-37
UNIPROTKB|Q0DRV6152 SODCC1 "Superoxide dismutase [ 0.792 0.980 0.513 4.4e-36
UNIPROTKB|Q0DTX5162 Os03g0219200 "Superoxide dismu 0.813 0.944 0.480 5.7e-36
TAIR|locus:2025595152 CSD1 "copper/zinc superoxide d 0.776 0.960 0.510 8.3e-35
TAIR|locus:2046168216 CSD2 "copper/zinc superoxide d 0.904 0.787 0.459 1.2e-33
UNIPROTKB|P93407211 SODCP "Superoxide dismutase [C 0.781 0.696 0.473 5.2e-33
TAIR|locus:2172324164 CSD3 "AT5G18100" [Arabidopsis 0.824 0.945 0.459 1.4e-32
MGI|MGI:98351154 Sod1 "superoxide dismutase 1, 0.797 0.974 0.460 2.3e-32
UNIPROTKB|G4NJK6158 MGG_02625 "Superoxide dismutas 0.813 0.968 0.455 6e-32
UNIPROTKB|P07509154 sod-1 "Superoxide dismutase [C 0.797 0.974 0.437 7.7e-32
UNIPROTKB|P28757 SODCC2 "Superoxide dismutase [Cu-Zn] 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 404 (147.3 bits), Expect = 1.1e-37, P = 1.1e-37
 Identities = 81/152 (53%), Positives = 102/152 (67%)

Query:    34 VNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYXXXXXXXXXXFHVHAAGDTRHECNSA 93
             V A+AV+   EG  KG+IFF Q+GD GPT + G           FHVHA GDT + C S 
Sbjct:     2 VKAVAVLASSEG-VKGTIFFSQEGD-GPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMST 59

Query:    94 GSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVI 153
             G HFNP    HG+ +DE+RHAGDLGN+     G A ++   D++I LTG HSIIGRA+V+
Sbjct:    60 GPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVN-VSDSQIPLTGAHSIIGRAVVV 118

Query:   154 HKDQDDFGRGGHNDSKSTGHAGERIACGVIGL 185
             H D DD G+GGH  SK+TG+AG R+ACG+IGL
Sbjct:   119 HADPDDLGKGGHELSKTTGNAGGRVACGIIGL 150
GO:0004784 "superoxide dismutase activity" evidence=IBA
GO:0005507 "copper ion binding" evidence=IBA
GO:0008270 "zinc ion binding" evidence=IBA
GO:0019430 "removal of superoxide radicals" evidence=IBA
UNIPROTKB|Q0DRV6 SODCC1 "Superoxide dismutase [Cu-Zn] 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DTX5 Os03g0219200 "Superoxide dismutase [Cu-Zn]" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2025595 CSD1 "copper/zinc superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046168 CSD2 "copper/zinc superoxide dismutase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93407 SODCP "Superoxide dismutase [Cu-Zn], chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2172324 CSD3 "AT5G18100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:98351 Sod1 "superoxide dismutase 1, soluble" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G4NJK6 MGG_02625 "Superoxide dismutase [Cu-Zn]" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|P07509 sod-1 "Superoxide dismutase [Cu-Zn]" [Neurospora crassa OR74A (taxid:367110)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P28757SODC2_ORYSJ1, ., 1, 5, ., 1, ., 10.57230.79250.9802yesno
P24704SODC1_ARATH1, ., 1, 5, ., 1, ., 10.55030.77650.9605yesno
Q01137SODC_SCHMA1, ., 1, 5, ., 1, ., 10.51940.80850.9934N/Ano
Q7M1R5SODC_SOYBN1, ., 1, 5, ., 1, ., 10.58550.79250.9802yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.10.914
3rd Layer1.15.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
BRADI1G18340.2
annotation not avaliable (152 aa)
(Brachypodium distachyon)
Predicted Functional Partners:
BRADI2G30580.1
annotation not avaliable (230 aa)
   •••• 0.766
BRADI1G51140.1
annotation not avaliable (256 aa)
      • 0.509
BRADI1G76330.1
annotation not avaliable (492 aa)
     •• 0.499
BRADI3G01470.1
annotation not avaliable (496 aa)
     •• 0.491
BRADI1G29800.1
annotation not avaliable (493 aa)
     •• 0.484

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 1e-51
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 1e-49
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 1e-47
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 1e-38
COG2032179 COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan 2e-29
PRK10290173 PRK10290, PRK10290, superoxide dismutase; Provisio 6e-11
PLN02957238 PLN02957, PLN02957, copper, zinc superoxide dismut 1e-10
PRK15388177 PRK15388, PRK15388, Cu/Zn superoxide dismutase; Pr 1e-05
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information 
 Score =  162 bits (411), Expect = 1e-51
 Identities = 90/152 (59%), Positives = 109/152 (71%), Gaps = 3/152 (1%)

Query: 34  VNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSA 93
           V A+AV+   EG  KG+IFF Q+GD GPT + G L GL PG HGFHVHA GDT + C S 
Sbjct: 2   VKAVAVLNSSEG-VKGTIFFTQEGD-GPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMST 59

Query: 94  GSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVI 153
           G HFNP    HG+ EDE+RHAGDLGN+ V   G A     +D +I LTGP+SI+GRA+V+
Sbjct: 60  GPHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGTATF-TIVDKQIPLTGPNSIVGRAVVV 118

Query: 154 HKDQDDFGRGGHNDSKSTGHAGERIACGVIGL 185
           H D DD G+GGH  SKSTG+AG R+ACG+IGL
Sbjct: 119 HADPDDLGKGGHELSKSTGNAGGRVACGIIGL 150

Length = 152
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182357 PRK10290, PRK10290, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|185286 PRK15388, PRK15388, Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 188
PLN02386152 superoxide dismutase [Cu-Zn] 100.0
PLN02642164 copper, zinc superoxide dismutase 100.0
KOG0441154 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Ino 100.0
PRK15388177 Cu/Zn superoxide dismutase; Provisional 100.0
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 100.0
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 100.0
PRK10290173 superoxide dismutase; Provisional 100.0
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 100.0
PLN02957238 copper, zinc superoxide dismutase 100.0
KOG4656247 consensus Copper chaperone for superoxide dismutas 100.0
PF07452119 CHRD: CHRD domain; InterPro: IPR010895 CHRD (after 81.02
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information 
Probab=100.00  E-value=3.6e-51  Score=322.54  Aligned_cols=150  Identities=59%  Similarity=1.033  Sum_probs=143.0

Q ss_pred             eEEEEEEeCCCCCcEEEEEEEEcCCCCcEEEEEEeccCCCCcceEEEeccCCCCcccccCCCCccCCCCCCCCCCCCCCC
Q 046448           34 VNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRH  113 (188)
Q Consensus        34 ~~Ava~l~~~~~~V~G~v~f~q~~~~~~v~v~v~i~GL~~g~h~~HIHe~gd~~~~c~saGgH~np~~~~h~~p~~~~~~  113 (188)
                      ++|+|+|++ ++.++|+|+|+|..+ +.+.|+++|+||+||.|+|||||+|||+++|.|+||||||+++.|+.|.+..||
T Consensus         2 ~~a~a~~~~-~~~v~G~v~f~q~~~-g~v~i~~~~~GL~pG~hg~HIHe~Gd~~~g~~SaGgHfnP~~~~Hg~~~~~~~H   79 (152)
T PLN02386          2 VKAVAVLNS-SEGVKGTIFFTQEGD-GPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRH   79 (152)
T ss_pred             ceEEEEEcC-CCCCEEEEEEEEcCC-CCEEEEEEEeCCCCCceeEEEeCCCCCCCCcccccCccCCCCCCCCCCCcccCc
Confidence            579999998 557999999999865 369999999999999999999999999999999999999999999999988999


Q ss_pred             CCccCCeEEcccccEEEEEEeecceeecCCCCCccceEEEeecCCCCCCCCCCCCCcCCCCCCeEEEEEEeec
Q 046448          114 AGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLL  186 (188)
Q Consensus       114 ~GDLgni~~~~~G~~~~~~~~d~~l~l~g~~siiGRSIVIH~~~dd~g~g~~~~s~~~G~aG~RiACgvI~~~  186 (188)
                      +||||||.++++|+++++ +++++++|.++++|+|||||||+++|||++++++.|+++|++|+|||||||++.
T Consensus        80 ~GDLgNi~~~~~G~a~~~-~~~~~~~L~g~~~i~GrslVIHa~~DD~~~~~~~~s~~~G~aG~RiACgvI~~~  151 (152)
T PLN02386         80 AGDLGNVTVGDDGTATFT-IVDKQIPLTGPNSIVGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151 (152)
T ss_pred             cccccCEEECCCCeEEEE-EECCceEeCCCCccCCcEEEEEccCCCcCCCcccccccCCCCCceEEEEEEEec
Confidence            999999999999999999 999999999999999999999999999999999999999999999999999975

>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG0441 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07452 CHRD: CHRD domain; InterPro: IPR010895 CHRD (after SWISS-PROT abbreviation for chordin) is a novel domain identified in chordin, an inhibitor of bone morphogenetic proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 2e-37
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 5e-33
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 3e-32
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 7e-32
3gtt_A153 Mouse Sod1 Length = 153 6e-31
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 1e-30
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 2e-30
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 3e-29
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 4e-29
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 5e-29
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 5e-29
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 5e-29
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 9e-29
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 1e-28
1n19_A154 Structure Of The Hsod A4v Mutant Length = 154 1e-28
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 2e-28
1e9p_A151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 2e-28
1e9p_B151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 2e-28
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 2e-28
1ba9_A153 The Solution Structure Of Reduced Monomeric Superox 3e-28
3sod_O152 Changes In Crystallographic Structure And Thermosta 3e-28
4bcy_A153 Monomeric Human Cu,zn Superoxide Dismutase, Mutatio 3e-28
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 3e-28
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 3e-28
1e9o_A152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 4e-28
1e9q_A151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 4e-28
3l9e_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 4e-28
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 4e-28
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 5e-28
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 5e-28
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 5e-28
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 5e-28
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 6e-28
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 6e-28
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 7e-28
1q0e_A152 Atomic Resolution (1.15 ) Crystal Structure Of Bovi 9e-28
1cob_A151 Crystal Structure Solution And Refinement Of The Se 9e-28
1e9q_B151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 9e-28
1e9o_B152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 9e-28
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 1e-27
1dsw_A153 The Solution Structure Of A Monomeric, Reduced Form 1e-27
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 2e-27
3l9y_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 2e-27
1sda_O152 Crystal Structure Of Peroxynitrite-Modified Bovine 2e-27
1f1g_A154 Crystal Structure Of Yeast Cuznsod Exposed To Nitri 2e-27
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 2e-27
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 2e-27
1sdy_A153 Structure Solution And Molecular Dynamics Refinemen 2e-27
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 2e-27
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 2e-27
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 2e-27
3gzo_A154 Human Sod1 G93a Variant Length = 154 2e-27
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 2e-27
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 2e-27
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 3e-27
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 3e-27
1cb4_A151 Crystal Structure Of Copper, Zinc Superoxide Dismut 3e-27
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 3e-27
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 4e-27
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 4e-27
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 4e-27
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 4e-27
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 4e-27
1f1a_A154 Crystal Structure Of Yeast H48q Cuznsod Fals Mutant 5e-27
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 6e-27
3h2p_A153 Human Sod1 D124v Variant Length = 153 6e-27
3gqf_A153 Structural And Biophysical Properties Of The Pathog 8e-27
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 8e-27
1jk9_A153 Heterodimer Between H48f-Ysod1 And Yccs Length = 15 1e-26
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 1e-26
1f18_A154 Crystal Structure Of Yeast Copper-Zinc Superoxide D 1e-26
1f1d_A154 Crystal Structure Of Yeast H46c Cuznsod Mutant Leng 1e-26
1b4t_A153 H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE 2e-26
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 4e-26
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 5e-26
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 6e-26
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 7e-26
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 3e-25
3kbe_A157 Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le 2e-23
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 3e-21
2jlp_A222 Crystal Structure Of Human Extracellular Copper-Zin 3e-17
1xtm_B175 Crystal Structure Of The Double Mutant Y88h-p104h O 5e-08
1xtl_B175 Crystal Structure Of P104h Mutant Of Sod-Like Prote 1e-07
4bcz_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 7e-07
4bd4_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 7e-07
1u3n_A162 A Sod-Like Protein From B. Subtilis, Unstructured I 1e-06
1s4i_B175 Crystal Structure Of A Sod-like Protein From Bacill 1e-06
1eso_A154 Monomeric Cu,Zn Superoxide Dismutase From Escherich 1e-04
1yai_A151 X-Ray Structure Of A Bacterial Copper,Zinc Superoxi 7e-04
1ibd_A151 X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant 7e-04
1ibf_A151 X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant 7e-04
1bzo_A151 Three-Dimensional Structure Of Prokaryotic Cu,Zn Su 8e-04
1ibh_A151 X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant 8e-04
1oal_A151 Active Site Copper And Zinc Ions Modulate The Quate 8e-04
1oaj_A151 Active Site Copper And Zinc Ions Modulate The Quate 9e-04
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure 
Iteration: 1

 Score =  151 bits (382), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 99/149 (66%), Gaps = 3/149 (2%)
Query: 37  IAVITGREGGPKGSIFFFQDGDHGPTILNGYXXXXXXXXXXFHVHAAGDTRHECNSAGSH 96
           +AV++  EG   G+I F Q+GD GPT + G           FHVHA GDT + C S G H
Sbjct: 5   VAVLSSSEG-VAGTILFTQEGD-GPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPH 62
Query: 97  FNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKD 156
           FNP    HGS EDE RHAGDLGN+ V   G A  +  +D +I LTGPHSIIGRA+V+H D
Sbjct: 63  FNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFT-IVDKQIPLTGPHSIIGRAVVVHAD 121
Query: 157 QDDFGRGGHNDSKSTGHAGERIACGVIGL 185
            DD G+GGH  SKSTG+AG RIACG+IGL
Sbjct: 122 PDDLGKGGHELSKSTGNAGGRIACGIIGL 150
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 Back     alignment and structure
>pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 Back     alignment and structure
>pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 Back     alignment and structure
>pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 Back     alignment and structure
>pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 Back     alignment and structure
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 Back     alignment and structure
>pdb|1XTM|B Chain B, Crystal Structure Of The Double Mutant Y88h-p104h Of A Sod-like Protein From Bacillus Subtilis. Length = 175 Back     alignment and structure
>pdb|1XTL|B Chain B, Crystal Structure Of P104h Mutant Of Sod-Like Protein From Bacillus Subtilis. Length = 175 Back     alignment and structure
>pdb|4BCZ|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form. Length = 110 Back     alignment and structure
>pdb|4BD4|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form, Mutant H43f Length = 110 Back     alignment and structure
>pdb|1U3N|A Chain A, A Sod-Like Protein From B. Subtilis, Unstructured In Solution, Becomes Ordered In The Crystal: Implications For Function And For Fibrillogenesis Length = 162 Back     alignment and structure
>pdb|1S4I|B Chain B, Crystal Structure Of A Sod-like Protein From Bacillus Subtilis Length = 175 Back     alignment and structure
>pdb|1ESO|A Chain A, Monomeric Cu,Zn Superoxide Dismutase From Escherichia Coli Length = 154 Back     alignment and structure
>pdb|1YAI|A Chain A, X-Ray Structure Of A Bacterial Copper,Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1IBD|A Chain A, X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant V29a Length = 151 Back     alignment and structure
>pdb|1IBF|A Chain A, X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant V29g Length = 151 Back     alignment and structure
>pdb|1BZO|A Chain A, Three-Dimensional Structure Of Prokaryotic Cu,Zn Superoxide Dismutase From P.Leiognathi, Solved By X-Ray Crystallography Length = 151 Back     alignment and structure
>pdb|1IBH|A Chain A, X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant M41i Length = 151 Back     alignment and structure
>pdb|1OAL|A Chain A, Active Site Copper And Zinc Ions Modulate The Quaternary Structure Of Prokaryotic Cu,Zn Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1OAJ|A Chain A, Active Site Copper And Zinc Ions Modulate The Quaternary Structure Of Prokaryotic Cu,Zn Superoxide Dismutase Length = 151 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 7e-61
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 7e-59
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 3e-58
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 4e-58
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 5e-58
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 6e-58
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 1e-57
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 1e-56
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 1e-56
1do5_A154 Human copper chaperone for superoxide dismutase do 2e-56
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 1e-55
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 1e-55
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 4e-49
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 3e-46
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 3e-46
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 7e-46
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 9e-46
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 8e-45
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 1e-42
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 3e-42
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 3e-42
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 9e-33
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 2e-31
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 3e-31
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
 Score =  185 bits (472), Expect = 7e-61
 Identities = 80/155 (51%), Positives = 103/155 (66%), Gaps = 2/155 (1%)

Query: 31  GNKVNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHEC 90
           G+ + A+ V+TG   G KG + F Q+ D+GP  ++    GL  G HGFHVH  GDT + C
Sbjct: 1   GSNMKAVCVMTG-TAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGC 59

Query: 91  NSAGSHFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRA 150
            SAG+HFNP    HG+ ED  RH GDLGN++    GNA  +   D  I L G HSIIGR+
Sbjct: 60  TSAGAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYN-ATDKLISLNGSHSIIGRS 118

Query: 151 IVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGL 185
           +VIH+++DD GRGGH  SK TG+AG R+ACGV+GL
Sbjct: 119 MVIHENEDDLGRGGHELSKVTGNAGGRLACGVVGL 153
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 100.0
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 100.0
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 100.0
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 100.0
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 100.0
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 100.0
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 100.0
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 100.0
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 100.0
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 100.0
1do5_A154 Human copper chaperone for superoxide dismutase do 100.0
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 100.0
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 100.0
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 100.0
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 100.0
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 100.0
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 100.0
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 100.0
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 100.0
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 100.0
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 100.0
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 100.0
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 100.0
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
Probab=100.00  E-value=3e-55  Score=345.16  Aligned_cols=152  Identities=47%  Similarity=0.849  Sum_probs=145.6

Q ss_pred             eEEEEEEeCCCCCcEEEEEEEEcCCCCcEEEEEEeccCCCCcceEEEeccCCCCcccccCCCCccCCCCCCCCCCCCCCC
Q 046448           34 VNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRH  113 (188)
Q Consensus        34 ~~Ava~l~~~~~~V~G~v~f~q~~~~~~v~v~v~i~GL~~g~h~~HIHe~gd~~~~c~saGgH~np~~~~h~~p~~~~~~  113 (188)
                      .+|||+|++ ++.|+|+|+|+|..+++.+.|+++|+|||||.|+|||||+|||+++|.|||+||||+++.|+.|++..||
T Consensus         2 ~~Avavl~g-~~~v~G~v~f~q~~~~~~v~v~~~i~GL~pG~hg~HIHe~Gd~s~gc~SaGgHfnP~~~~Hg~p~~~~~h   80 (153)
T 4a7u_A            2 TKAVCVLKG-DGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERH   80 (153)
T ss_dssp             EEEEEEEBC-SSSCEEEEEEEESSTTCCEEEEEEEESCCSEEEEEEEESCCCCTTSGGGGCSBCCTTCCCCCCTTCSSCC
T ss_pred             cEEEEEEcC-CCccEEEEEEEEeCCCCcEEEEEEEECCCCCcccEEEeecCccccccccccCeecccCCcCCCCCcCCCc
Confidence            589999998 6789999999999864579999999999999999999999999999999999999999999999999999


Q ss_pred             CCccCCeEEcccccEEEEEEeecceeecCCCCCccceEEEeecCCCCCCCCCCCCCcCCCCCCeEEEEEEeecc
Q 046448          114 AGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLLS  187 (188)
Q Consensus       114 ~GDLgni~~~~~G~~~~~~~~d~~l~l~g~~siiGRSIVIH~~~dd~g~g~~~~s~~~G~aG~RiACgvI~~~~  187 (188)
                      +||||||+++.+|.++++ |+|+.++|+|+++|+|||||||+++||||+|+++.|+++||+|+|||||||++++
T Consensus        81 ~GDLgni~~~~~G~a~~~-~~d~~isL~g~~~iiGRsiVIHa~~Dd~g~g~~~~s~~tGnaG~RiaCgvI~~~~  153 (153)
T 4a7u_A           81 VGDLGNVTADKDGVADVS-IEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ  153 (153)
T ss_dssp             TTEEEEEEECTTSCEEEE-EEESSCBSSGGGBCTTSEEEEESSCCCTTCSSSGGGGTTTTCCSEEEEEECEECC
T ss_pred             cCcccCeEeCCCceEEEE-EEcCceEecCCcccCCeEEEEEcCCccCCCCCCcCcccCCCCcCeEEEEEEEEeC
Confidence            999999999999999999 9999999999999999999999999999999999999999999999999999864
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 188
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 7e-45
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 9e-45
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 1e-42
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 5e-42
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 1e-41
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 2e-39
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 8e-32
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 3e-30
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 3e-30
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 5e-30
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 1e-27
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 7e-23
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  143 bits (362), Expect = 7e-45
 Identities = 73/150 (48%), Positives = 95/150 (63%), Gaps = 2/150 (1%)

Query: 36  AIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGS 95
           A+ V+ G +G  +G I F Q   +GP  + G + GL  G HGFHVH  GD    C SAG 
Sbjct: 4   AVCVLKG-DGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGP 62

Query: 96  HFNPHNMLHGSKEDEHRHAGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHK 155
           HFNP +  HG  +DE RH GDLGN+  D  G A +S   D+ I L+G H IIGR +V+H+
Sbjct: 63  HFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVS-IEDSVISLSGDHCIIGRTLVVHE 121

Query: 156 DQDDFGRGGHNDSKSTGHAGERIACGVIGL 185
             DD G+GG+ +S  TG+AG R+ACGVIG+
Sbjct: 122 KADDLGKGGNEESTKTGNAGSRLACGVIGI 151
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 100.0
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 100.0
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 100.0
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 100.0
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 100.0
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 100.0
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 100.0
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 100.0
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 100.0
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 100.0
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 100.0
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 100.0
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Blood fluke (Schistosoma mansoni) [TaxId: 6183]

Probab=100.00  E-value=6.6e-53  Score=330.89  Aligned_cols=152  Identities=52%  Similarity=0.918  Sum_probs=146.2

Q ss_pred             eEEEEEEeCCCCCcEEEEEEEEcCCCCcEEEEEEeccCCCCcceEEEeccCCCCcccccCCCCccCCCCCCCCCCCCCCC
Q 046448           34 VNAIAVITGREGGPKGSIFFFQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFNPHNMLHGSKEDEHRH  113 (188)
Q Consensus        34 ~~Ava~l~~~~~~V~G~v~f~q~~~~~~v~v~v~i~GL~~g~h~~HIHe~gd~~~~c~saGgH~np~~~~h~~p~~~~~~  113 (188)
                      .+|+|+|++ ++.|+|+|+|+|..+++.+.|+++|+||+||.|+|||||+|||+++|.|+|+||||++..|+.|.+..+|
T Consensus         4 ~~Ava~~~g-~~~v~G~v~F~Q~~~~~~v~V~~~l~GL~pG~hg~HIHe~Gd~s~~~~saGgH~nP~~~~hg~~~~~~~h   82 (156)
T d1to4a_           4 MKAVCVMTG-TAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRH   82 (156)
T ss_dssp             CEEEEEEBC-SSSCEEEEEEEESSTTSCEEEEEEEESCCSEEEEEEEESCCCCTTTTGGGCSBCCTTCCCCCCTTCSSCC
T ss_pred             eEEEEEEcC-CCCcEEEEEEEEECCCCcEEEEEEEccCCCcceeeEEcCCCccCCcccccccccccccccccCCCcccCc
Confidence            489999998 6789999999999877789999999999999999999999999999999999999999999999999999


Q ss_pred             CCccCCeEEcccccEEEEEEeecceeecCCCCCccceEEEeecCCCCCCCCCCCCCcCCCCCCeEEEEEEeecc
Q 046448          114 AGDLGNLIVDVYGNAYLSHFLDNKIRLTGPHSIIGRAIVIHKDQDDFGRGGHNDSKSTGHAGERIACGVIGLLS  187 (188)
Q Consensus       114 ~GDLgni~~~~~G~~~~~~~~d~~l~l~g~~siiGRSIVIH~~~dd~g~g~~~~s~~~G~aG~RiACgvI~~~~  187 (188)
                      .|||+|+.++.+|.++++ ++++.++|+++++|+|||||||+++|||+++++++|+++|++|+|||||||+++.
T Consensus        83 ~GDlgni~~~~~G~~~~~-~~d~~l~l~g~~~iiGRsiVIH~~~Dd~~~~~~~~s~~~G~aG~RiACgvIg~a~  155 (156)
T d1to4a_          83 VGDLGNVVAGADGNAVYN-ATDKLISLNGSHSIIGRSMVIHENEDDLGRGGHELSKVTGNAGGRLACGVVGLAA  155 (156)
T ss_dssp             TTEEEEEEECTTSCEEEE-EEESSCBSSGGGBCTTSEEEEESSCCCTTCSCSTTHHHHTTCCSEEEEEECEECC
T ss_pred             cCccccEEeCCCceEEEE-EECceeecCCcCCcCCcEEEEECCCCccccCCcccccccCCCCceEEEEEEEEec
Confidence            999999999999999999 9999999999999999999999999999999999999999999999999999974
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure