Citrus Sinensis ID: 046456

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MALLLLHLFTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQLPPNPETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKDIEPLN
cHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccEEEcccEEccccEEEcccccccEEEEEEcccEEEEccccccEEcEEEEEEEEEEcccccccccEEEEEEccccccccccccccccEEEccccccccc
ccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccEEEEEccEEEccEEEEEccccccEEEEEEcccEEcEccccccEcEEEEEEEEEEEcccccccccEEEEEEEEccccccccccccccEEEEEccccccc
MALLLLHLFTITTWLSILRIPLLASAlsfnyssfsplsddnityqraypdsnrmiqlppnpetagratynkpmhlwdkTTRNLADFTTHFSFVIDSQKRTICADGLAfflapqgapatanddkgggslgltkdiepln
MALLLLHLFTITTWLSILRIPLLASALSFNYssfsplsddNITYQRAYPDSNRMIQLPPNPETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGapatanddkgggslgltkdiepln
MALLLLHLFTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQLPPNPETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKDIEPLN
**LLLLHLFTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQR*********************TYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAP**************************
*ALLLLHLFTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQLPPNPETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGA***********S****K******
MALLLLHLFTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQLPPNPETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKDIEPLN
MALLLLHLFTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQLPPNPETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLLLHLFTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQLPPNPETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKDIEPLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q39527 290 Lectin-related protein (F N/A no 0.818 0.389 0.360 6e-13
P93535 292 Seed lectin OS=Styphnolob N/A no 0.855 0.404 0.377 7e-13
Q93X49 275 Lectin OS=Lens culinaris N/A no 0.710 0.356 0.384 9e-13
Q93WH6 275 Lectin OS=Lens culinaris N/A no 0.710 0.356 0.384 1e-12
P86353 239 Seed lectin beta chain OS N/A no 0.739 0.426 0.408 1e-12
P86352 251 Seed lectin alpha chain O N/A no 0.739 0.406 0.408 2e-12
Q41160 272 Putative bark agglutinin N/A no 0.818 0.415 0.387 2e-12
Q41159 285 Bark agglutinin I polypep N/A no 0.746 0.361 0.4 2e-12
P81371 240 Seed lectin OS=Vatairea m N/A no 0.768 0.441 0.387 2e-12
P04122181 Lectin beta-1 and beta-2 N/A no 0.710 0.541 0.384 4e-12
>sp|Q39527|LECR_CLAKE Lectin-related protein (Fragment) OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 64/122 (52%), Gaps = 9/122 (7%)

Query: 10  TITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQL------PPNPET 63
           +IT +L +L       ALSF ++ F    D+ +    A   S   +QL       P P +
Sbjct: 23  SITFYLLLLNKVNSEEALSFTFTKFVSNQDELLLQGDALVSSKGELQLTRVENGQPIPHS 82

Query: 64  AGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDK 123
            GRA Y+ P+H+WD +T ++A F T F+FV+++      ADG+AFFLAP   P T     
Sbjct: 83  VGRALYSDPVHIWDSSTGSVASFVTSFTFVVEAPNENKTADGIAFFLAP---PDTQVQSL 139

Query: 124 GG 125
           GG
Sbjct: 140 GG 141
Does not have any carbohydrate binding or agglutination activity.
Cladrastis kentukea (taxid: 38412)
>sp|P93535|LECS_STYJP Seed lectin OS=Styphnolobium japonicum PE=2 SV=1 Back     alignment and function description
>sp|Q93X49|LEC_LENCO Lectin OS=Lens culinaris subsp. orientalis PE=3 SV=2 Back     alignment and function description
>sp|Q93WH6|LEC_LENCC Lectin OS=Lens culinaris subsp. culinaris PE=3 SV=2 Back     alignment and function description
>sp|P86353|LECB_SPAPA Seed lectin beta chain OS=Spatholobus parviflorus PE=1 SV=1 Back     alignment and function description
>sp|P86352|LECA_SPAPA Seed lectin alpha chain OS=Spatholobus parviflorus PE=1 SV=1 Back     alignment and function description
>sp|Q41160|LCB3_ROBPS Putative bark agglutinin LECRPA3 (Fragment) OS=Robinia pseudoacacia PE=2 SV=2 Back     alignment and function description
>sp|Q41159|LCB1_ROBPS Bark agglutinin I polypeptide A OS=Robinia pseudoacacia PE=1 SV=1 Back     alignment and function description
>sp|P81371|LECS_VATMA Seed lectin OS=Vatairea macrocarpa PE=1 SV=1 Back     alignment and function description
>sp|P04122|LECB_LATOC Lectin beta-1 and beta-2 chains OS=Lathyrus ochrus PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
224096774 713 predicted protein [Populus trichocarpa] 0.913 0.176 0.514 3e-25
224056347 615 predicted protein [Populus trichocarpa] 0.898 0.201 0.5 5e-25
224092745 681 predicted protein [Populus trichocarpa] 0.898 0.182 0.492 1e-23
357476157 782 Class I heat shock protein [Medicago tru 0.811 0.143 0.513 2e-23
147765964 692 hypothetical protein VITISV_007747 [Viti 0.920 0.183 0.514 2e-22
296088135 546 unnamed protein product [Vitis vinifera] 0.927 0.234 0.496 3e-22
225470605 720 PREDICTED: L-type lectin-domain containi 0.927 0.177 0.496 3e-22
224056339 254 predicted protein [Populus trichocarpa] 0.905 0.492 0.510 4e-22
255562072 606 kinase, putative [Ricinus communis] gi|2 0.818 0.186 0.516 1e-20
356519481 691 PREDICTED: L-type lectin-domain containi 0.855 0.170 0.507 2e-20
>gi|224096774|ref|XP_002334671.1| predicted protein [Populus trichocarpa] gi|222874064|gb|EEF11195.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 90/136 (66%), Gaps = 10/136 (7%)

Query: 9   FTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQLPPNPETA---- 64
           F  +T  +++ IP  AS LSFN++SF   +D NI+Y+ AYP ++  IQL  N   A    
Sbjct: 11  FVFSTLFTLI-IPS-ASGLSFNFTSFIVGADQNISYEEAYP-ADGAIQLTKNLRNANMNS 67

Query: 65  --GRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDD 122
             GRATY KPM LWD+ + NL DFTTHFSF IDSQ+RT   DGLAFFLAP+G+   +N  
Sbjct: 68  SSGRATYYKPMQLWDEASGNLTDFTTHFSFSIDSQRRTAYGDGLAFFLAPEGSKLPSNLS 127

Query: 123 KGGGSLGLTKDIEPLN 138
           +G G LGLT+  + LN
Sbjct: 128 EGAG-LGLTRRDQLLN 142

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224056347|ref|XP_002298814.1| predicted protein [Populus trichocarpa] gi|222846072|gb|EEE83619.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224092745|ref|XP_002334872.1| predicted protein [Populus trichocarpa] gi|222831889|gb|EEE70366.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357476157|ref|XP_003608364.1| Class I heat shock protein [Medicago truncatula] gi|355509419|gb|AES90561.1| Class I heat shock protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|147765964|emb|CAN70210.1| hypothetical protein VITISV_007747 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088135|emb|CBI35556.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225470605|ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224056339|ref|XP_002298810.1| predicted protein [Populus trichocarpa] gi|222846068|gb|EEE83615.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255562072|ref|XP_002522044.1| kinase, putative [Ricinus communis] gi|223538643|gb|EEF40244.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356519481|ref|XP_003528401.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
UNIPROTKB|P02870 275 P02870 "Lectin" [Lens culinari 0.891 0.447 0.325 5.4e-13
UNIPROTKB|P83721234 P83721 "Mannose/glucose-specif 0.768 0.452 0.370 2.8e-11
UNIPROTKB|Q70DJ5 280 Q70DJ5 "Alpha-methyl-mannoside 0.898 0.442 0.338 2.1e-10
TAIR|locus:2155685 675 AT5G65600 [Arabidopsis thalian 0.833 0.170 0.347 3e-10
UNIPROTKB|P81517236 P81517 "Lectin alpha chain" [C 0.869 0.508 0.350 1.1e-09
UNIPROTKB|B3EWJ2237 B3EWJ2 "Lectin alpha chain" [D 0.869 0.506 0.325 4.5e-09
TAIR|locus:2162212 681 AT5G55830 [Arabidopsis thalian 0.913 0.185 0.323 4.6e-09
UNIPROTKB|Q40987 270 NLEC1 "Nodule lectin" [Pisum s 0.804 0.411 0.330 5.6e-09
UNIPROTKB|P58907237 P58907 "Lectin alpha chain" [D 0.869 0.506 0.333 5.9e-09
UNIPROTKB|P81637237 P81637 "Lectin alpha chain" [D 0.869 0.506 0.325 1e-08
UNIPROTKB|P02870 P02870 "Lectin" [Lens culinaris (taxid:3864)] Back     alignment and assigned GO terms
 Score = 172 (65.6 bits), Expect = 5.4e-13, P = 5.4e-13
 Identities = 43/132 (32%), Positives = 67/132 (50%)

Query:     1 MALLLLHLFTITTWLSILRIPLLASALSFNYSSFSPLSDDNITYQR-AYPDSNRMIQLPP 59
             ++  L+ L  + T +   ++    +  SF+ + FSP    N+ +Q   Y    ++     
Sbjct:     9 ISFYLIFLSILLTTIFFFKVNSTETT-SFSITKFSP-DQKNLIFQGDGYTTKGKLTLTKA 66

Query:    60 NPETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGA-PAT 118
                T GRA Y+ P+H+WD+ T N+A+F T F+FVID+      AD   FF+AP    P T
Sbjct:    67 VKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADEFTFFIAPVDTKPQT 126

Query:   119 ANDDKGGGSLGL 130
                  GGG LG+
Sbjct:   127 -----GGGYLGV 133
GO:0005509 "calcium ion binding" evidence=IDA
GO:0009756 "carbohydrate mediated signaling" evidence=TAS
GO:0030145 "manganese ion binding" evidence=IDA
GO:0030246 "carbohydrate binding" evidence=IDA
UNIPROTKB|P83721 P83721 "Mannose/glucose-specific lectin Cramoll" [Cratylia mollis (taxid:252530)] Back     alignment and assigned GO terms
UNIPROTKB|Q70DJ5 Q70DJ5 "Alpha-methyl-mannoside-specific lectin" [Arachis hypogaea (taxid:3818)] Back     alignment and assigned GO terms
TAIR|locus:2155685 AT5G65600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P81517 P81517 "Lectin alpha chain" [Cratylia argentea (taxid:83131)] Back     alignment and assigned GO terms
UNIPROTKB|B3EWJ2 B3EWJ2 "Lectin alpha chain" [Dioclea sclerocarpa (taxid:1176036)] Back     alignment and assigned GO terms
TAIR|locus:2162212 AT5G55830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40987 NLEC1 "Nodule lectin" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
UNIPROTKB|P58907 P58907 "Lectin alpha chain" [Dioclea virgata (taxid:167618)] Back     alignment and assigned GO terms
UNIPROTKB|P81637 P81637 "Lectin alpha chain" [Dioclea guianensis (taxid:99571)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.17120001
hypothetical protein (713 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
cd06899 236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 5e-29
pfam00139 231 pfam00139, Lectin_legB, Legume lectin domain 3e-22
cd01951 223 cd01951, lectin_L-type, legume lectins 6e-08
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
 Score =  105 bits (264), Expect = 5e-29
 Identities = 46/111 (41%), Positives = 59/111 (53%), Gaps = 8/111 (7%)

Query: 27  LSFNYSSFSPLSDDNITYQR-AYPDSNRMIQLPPN---PETAGRATYNKPMHLWDKTTRN 82
           LSFN++ FS     N+T Q  A   SN  +QL  +     + GRA Y+KP+ LWD TT  
Sbjct: 1   LSFNFNGFSS-DQSNLTLQGDATISSNGALQLTNDTSPASSVGRALYSKPVRLWDSTTGK 59

Query: 83  LADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKD 133
           +A F+T FSF I     ++  DGLAFFLAP     +      GG LGL   
Sbjct: 60  VASFSTSFSFSITPPNPSLGGDGLAFFLAP---TDSLPPASSGGYLGLFNS 107

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236
>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
cd06899 236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 99.93
PF00139 236 Lectin_legB: Legume lectin domain; InterPro: IPR00 99.92
cd01951 223 lectin_L-type legume lectins. The L-type (legume-t 99.59
cd07308 218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 99.19
cd06901 248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 99.04
PF03388 229 Lectin_leg-like: Legume-like lectin family; InterP 97.57
cd06902 225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 97.47
cd06900 255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 97.45
cd06903 215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 97.23
KOG3839 351 consensus Lectin VIP36, involved in the transport 89.53
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
Probab=99.93  E-value=1.2e-25  Score=178.38  Aligned_cols=106  Identities=43%  Similarity=0.704  Sum_probs=93.7

Q ss_pred             eeEEeCCCCCCCCCCeEEE-eeeeCCCCeEEcCC-C--CCCeEEEEecCCEeecCCCCCceeeeEEEEEEEEeeCCCCCC
Q 046456           27 LSFNYSSFSPLSDDNITYQ-RAYPDSNRMIQLPP-N--PETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDSQKRTIC  102 (138)
Q Consensus        27 ~sF~f~~F~~~~~~~l~l~-~A~~~~~g~L~LT~-s--~~s~Gra~Y~~Pv~lwd~~t~~~aSFsT~FsF~I~~~~~~~~  102 (138)
                      ++|+|++|... .+++.++ +|.+..++.|+||+ .  .+++|||+|++||++|++.+++++||+|+|+|.|.+.+...+
T Consensus         1 ~~f~f~~f~~~-~~~l~l~G~A~~~~~~~i~LT~~~~~~~~~G~v~y~~pi~l~~~~~~~~~sFst~F~F~i~~~~~~~~   79 (236)
T cd06899           1 LSFNFNGFSSD-QSNLTLQGDATISSNGALQLTNDTSPASSVGRALYSKPVRLWDSTTGKVASFSTSFSFSITPPNPSLG   79 (236)
T ss_pred             CceecCCCCCC-CCCEEEecceEcCCCCeEEecCCCCCCcceEEEEeCCCEEeecCCCCCceeEEEEEEEEEEcCCCCCC
Confidence            47999999864 5789999 99994489999999 7  899999999999999999999999999999999999876779


Q ss_pred             CCccEEEeccCCCCCCCCCCCCCCeeeeecCCCC
Q 046456          103 ADGLAFFLAPQGAPATANDDKGGGSLGLTKDIEP  136 (138)
Q Consensus       103 gdGlAF~l~p~~~~~p~~~~s~g~~LGL~n~~~~  136 (138)
                      ||||||+|+|.... +.+  ..|+|||+++.+++
T Consensus        80 gdGlAF~i~~~~~~-~~~--~~G~~lG~~~~~~~  110 (236)
T cd06899          80 GDGLAFFLAPTDSL-PPA--SSGGYLGLFNSSNN  110 (236)
T ss_pred             CCeEEEEEecCCCC-CCC--CCcceeeeecCCCC
Confidence            99999999998755 445  88999999987653

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
3ipv_B 239 Crystal Structure Of Spatholobus Parviflorus Seed L 1e-13
3ipv_A 251 Crystal Structure Of Spatholobus Parviflorus Seed L 1e-13
2lal_A181 Crystal Structure Determination And Refinement At 2 2e-13
1lof_C181 X-Ray Structure Of A Biantennary Octasaccharide-Lec 4e-13
1loa_A181 Three-Dimensional Structures Of Complexes Of Lathyr 4e-13
2bqp_A 234 The Structure Of The Pea Lectin-D-Glucopyranose Com 6e-13
1rin_A180 X-Ray Crystal Structure Of A Pea Lectin-Trimannosid 8e-13
1lgb_A181 Interaction Of A Legume Lectin With The N2 Fragment 9e-13
1ofs_A187 Pea Lectin-sucrose Complex Length = 187 9e-13
1lgc_A181 Interaction Of A Legume Lectin With The N2 Fragment 9e-13
2ltn_A181 Design, Expression, And Crystallization Of Recombin 9e-13
3n35_A 242 Erythrina Corallodendron Lectin Mutant (Y106g) With 2e-12
2b7y_A182 Fava Bean Lectin-Glucose Complex Length = 182 3e-12
1fny_A 237 Legume Lectin Of The Bark Of Robinia Pseudoacacia. 3e-12
1gz9_A 239 High-Resolution Crystal Structure Of Erythrina Cris 1e-11
3usu_A 256 Crystal Structure Of Butea Monosperma Seed Lectin L 1e-11
3usu_B 242 Crystal Structure Of Butea Monosperma Seed Lectin L 2e-11
1wbf_A 242 Winged Bean Lectin, Saccharide Free Form Length = 2 2e-11
1wbl_A 241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 2e-11
2e7q_A 237 Crystal Structure Of Basic Winged Bean Lectin In Co 2e-11
1ax0_A 239 Erythrina Corallodendron Lectin In Complex With N-A 2e-11
1fyu_A 255 Crystal Structure Of Erythrina Corallodendron Lecti 2e-11
1n47_A 233 Isolectin B4 From Vicia Villosa In Complex With The 2e-11
1sfy_A 239 Crystal Structure Of Recombinant Erythrina Corallod 2e-11
1lte_A 239 Structure Of A Legume Lectin With An Ordered N-Link 2e-11
2sba_A 253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 3e-11
1uzy_A 242 Erythrina Crystagalli Lectin Length = 242 5e-11
1qnw_A 242 Lectin Ii From Ulex Europaeus Length = 242 8e-11
2eig_A 234 Lotus Tetragonolobus Seed Lectin (Isoform) Length = 2e-10
1dbn_A 239 Maackia Amurensis Leukoagglutinin (Lectin) With Sia 3e-10
1fay_A 238 Winged Bean Acidic Lectin Complexed With Methyl-Alp 1e-09
1mvq_A236 Cratylia Mollis Lectin (Isoform 1) In Complex With 1e-09
1bzw_A 232 Peanut Lectin Complexed With C-Lactose Length = 232 2e-09
2pel_A 236 Peanut Lectin Length = 236 2e-09
1fat_A 252 Phytohemagglutinin-L Length = 252 5e-09
3ujo_A 281 Galactose-Specific Seed Lectin From Dolichos Lablab 6e-09
1g8w_A 233 Improved Structure Of Phytohemagglutinin-L From The 7e-09
2d3p_A236 Cratylia Floribunda Seed Lectin Crystallized At Bas 1e-08
1fx5_A 242 Crystal Structure Analysis Of Ulex Europaeus Lectin 2e-08
1n3o_A 252 Pterocarcpus Angolensis Lectin In Complex With Alph 4e-08
1q8o_A 252 Pterocartpus Angolensis Lectin Pal In Complex With 4e-08
1bjq_A 253 The Dolichos Biflorus Seed Lectin In Complex With A 4e-08
1qmo_A113 Structure Of Fril, A Legume Lectin That Delays Hema 4e-08
1hql_A 257 The Xenograft Antigen In Complex With The B4 Isolec 5e-08
1gnz_A 257 Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m 5e-08
3u4x_A236 Crystal Structure Of A Lectin From Camptosema Pedic 1e-07
1ioa_A 240 Arcelin-5, A Lectin-Like Defense Protein From Phase 1e-07
2jec_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 2e-07
2jdz_A239 Crystal Structure Of Recombinant Dioclea Guianensis 2e-07
3zvx_A 261 Structure Of The Lectin From Platypodium Elegans In 5e-07
2je9_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 5e-07
1dgl_A237 Lectin From Dioclea Grandiflora Complexed To Triman 6e-07
3rrd_A237 Native Structure Of Dioclea Virgata Lectin Length = 7e-07
2je7_A239 Crystal Structure Of Recombinant Dioclea Guianensis 8e-07
3sh3_A237 Crystal Structure Of A Pro-Inflammatory Lectin From 1e-06
1h9p_A237 Crystal Structure Of Dioclea Guianensis Seed Lectin 1e-06
1avb_A 226 Arcelin-1 From Phaseolus Vulgaris L Length = 226 2e-06
2gdf_A237 Crystal Structure Of Dioclea Violacea Seed Lectin L 2e-06
1h9w_A237 Native Dioclea Guianensis Seed Lectin Length = 237 2e-06
2zbj_A237 Crystal Structure Of Dioclea Rostrata Lectin Length 2e-06
1gsl_A 243 Lectin (Fourth Isolated From (Griffonia Simplicifol 5e-06
2fmd_A 240 Structural Basis Of Carbohydrate Recognition By Bow 5e-06
1lul_A 253 Db58, A Legume Lectin From Dolichos Biflorus Length 5e-06
1dhk_B 223 Structure Of Porcine Pancreatic Alpha-Amylase Lengt 7e-05
1viw_B205 Tenebrio Molitor Alpha-Amylase-Inhibitor Complex Le 8e-05
2ow4_A237 Crystal Structure Of A Lectin From Canavalia Mariti 2e-04
2cwm_A237 Native Crystal Structure Of No Releasing Inductive 3e-04
2yz4_A237 The Neutron Structure Of Concanavalin A At 2.2 Angs 5e-04
2ctv_A237 High Resolution Crystallographic Studies Of Native 6e-04
1wuv_A237 Crystal Structure Of Native Canavalia Gladiata Lect 6e-04
2ovu_A237 Crystal Strucure Of A Lectin From Canavalia Gladiat 6e-04
1azd_A237 Concanavalin From Canavalia Brasiliensis Length = 2 8e-04
1cn1_A237 Crystal Structure Of Demetallized Concanavalin A. T 9e-04
>pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 58/115 (50%), Gaps = 13/115 (11%)
Query: 24  ASALSFNYSSFSPLSDDNITYQRAYPDSNRMIQLP-------PNPETAGRATYNKPMHLW 76
           A   SF +S F PL  + I    A      ++QL        P P + GRATY+ P+++W
Sbjct: 1   AEETSFVFSKFKPLEPNLILQGDALVTVAGVLQLTNVDSNGVPEPSSLGRATYSAPINIW 60
Query: 77  DKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAP-QGAPATANDDKGGGSLGL 130
           D  T  +A F T F F I +      ADGLAFFLAP   AP     D GGG LGL
Sbjct: 61  DSATGLVASFATSFRFTIYAPNIATIADGLAFFLAPVASAP-----DSGGGFLGL 110
>pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 Back     alignment and structure
>pdb|2LAL|A Chain A, Crystal Structure Determination And Refinement At 2.3 Angstroms Resolution Of The Lentil Lectin Length = 181 Back     alignment and structure
>pdb|1LOF|C Chain C, X-Ray Structure Of A Biantennary Octasaccharide-Lectin Complex At 2.3 Angstroms Resolution Length = 181 Back     alignment and structure
>pdb|1LOA|A Chain A, Three-Dimensional Structures Of Complexes Of Lathyrus Ochrus Isolectin I With Glucose And Mannose: Fine Specificity Of The Monosaccharide-Binding Site Length = 181 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|1RIN|A Chain A, X-Ray Crystal Structure Of A Pea Lectin-Trimannoside Complex At 2.6 Angstroms Resolution Length = 180 Back     alignment and structure
>pdb|1LGB|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 Back     alignment and structure
>pdb|1OFS|A Chain A, Pea Lectin-sucrose Complex Length = 187 Back     alignment and structure
>pdb|1LGC|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 Back     alignment and structure
>pdb|2LTN|A Chain A, Design, Expression, And Crystallization Of Recombinant Lectin From The Garden Pea (Pisum Sativum) Length = 181 Back     alignment and structure
>pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 Back     alignment and structure
>pdb|2B7Y|A Chain A, Fava Bean Lectin-Glucose Complex Length = 182 Back     alignment and structure
>pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 Back     alignment and structure
>pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 Back     alignment and structure
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 Back     alignment and structure
>pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 Back     alignment and structure
>pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 Back     alignment and structure
>pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 Back     alignment and structure
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 Back     alignment and structure
>pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 Back     alignment and structure
>pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|1BZW|A Chain A, Peanut Lectin Complexed With C-Lactose Length = 232 Back     alignment and structure
>pdb|2PEL|A Chain A, Peanut Lectin Length = 236 Back     alignment and structure
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure
>pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 Back     alignment and structure
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|1FX5|A Chain A, Crystal Structure Analysis Of Ulex Europaeus Lectin I Length = 242 Back     alignment and structure
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|1QMO|A Chain A, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 113 Back     alignment and structure
>pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 Back     alignment and structure
>pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|1IOA|A Chain A, Arcelin-5, A Lectin-Like Defense Protein From Phaseolus Vulgaris Length = 240 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1AVB|A Chain A, Arcelin-1 From Phaseolus Vulgaris L Length = 226 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|1GSL|A Chain A, Lectin (Fourth Isolated From (Griffonia Simplicifolia)) Complex With Y Human Blood Group Determinant Length = 243 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|1DHK|B Chain B, Structure Of Porcine Pancreatic Alpha-Amylase Length = 223 Back     alignment and structure
>pdb|1VIW|B Chain B, Tenebrio Molitor Alpha-Amylase-Inhibitor Complex Length = 205 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 Back     alignment and structure
>pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
1dbn_A 239 MAL, protein (leukoagglutinin); plant lectin, carb 1e-21
1qmo_A113 Mannose binding lectin, FRIL; crosslink, hematopoi 8e-21
2eig_A 234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 9e-21
1sbf_A 253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 1e-20
1avb_A 226 Arcelin-1; lectin-like glycoprotein, plant defense 2e-20
1dhk_B 223 Bean lectin-like inhibitor, porcine pancreatic alp 4e-20
3ipv_A 251 Lectin alpha chain; galactose binding, SEED lectin 4e-20
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 4e-20
1fat_A 252 Phytohemagglutinin-L; glycoprotein, plant defense 1e-19
1fx5_A 242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 3e-19
2bqp_A 234 Protein (PEA lectin); D-glucopyranose complex, sug 4e-19
1hql_A 257 Lectin; xenograft antigen, sugar BI protein; HET: 5e-19
1gzc_A 239 Erythrina crista-galli lectin; carbohydrate, sugar 1e-18
1f9k_A 238 Acidic lectin; legume lectin, glycosylated protein 2e-18
1wbf_A 242 Protein (agglutinin); lectin (agglutinin), legume 2e-18
1fny_A 237 BARK lectin, BARK agglutinin I,polypeptide A; legu 2e-18
1v6i_A 232 Agglutinin, PNA, galactose-binding lectin; open qu 7e-18
1g7y_A 253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 1e-17
3zyr_A 261 Lectin; sugar binding protein, N-glycan; HET: NAG 1e-17
1qnw_A 242 Chitin binding lectin, UEA-II; carbohydrate bindin 2e-17
1ioa_A 240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 1e-16
1n47_A 233 Isolectin B4; cancer antigen, vicia villosa lectin 1e-16
1gsl_A 243 Griffonia simplicifolia lectin 4; glycoprotein, ma 3e-15
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 5e-15
2fmd_A 240 Lectin, agglutinin, BMA; legume lectin, beta sandw 1e-14
1gv9_A 260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 4e-05
2dur_A 253 VIP36;, vesicular integral-membrane protein VIP36; 1e-04
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
 Score = 86.0 bits (212), Expect = 1e-21
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 10/114 (8%)

Query: 24  ASALSFNYSSFSPLSDDNITYQR-AYPDSNRMIQL------PPNPETAGRATYNKPMHLW 76
           +  LSF  ++F P ++ ++ +Q  A   S  ++QL       P   + GRA Y  P+ +W
Sbjct: 1   SDELSFTINNFVP-NEADLLFQGEASVSSTGVLQLTKVENGQPQKYSVGRALYAAPVRIW 59

Query: 77  DKTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGL 130
             TT ++A F+T F+FV+ +    I +DGLAF+LAP  +   +        LGL
Sbjct: 60  GNTTGSVASFSTSFTFVVKAPNPDITSDGLAFYLAPPDSQIPSGS--VSKYLGL 111
>1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 113 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
1qmo_A113 Mannose binding lectin, FRIL; crosslink, hematopoi 100.0
3ujo_A 281 Legume lectin; carbohydrate-binding, galactose, ad 100.0
3zyr_A 261 Lectin; sugar binding protein, N-glycan; HET: NAG 100.0
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 99.97
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 99.97
1dbn_A 239 MAL, protein (leukoagglutinin); plant lectin, carb 99.97
3ipv_A 251 Lectin alpha chain; galactose binding, SEED lectin 99.97
1qnw_A 242 Chitin binding lectin, UEA-II; carbohydrate bindin 99.97
1v6i_A 232 Agglutinin, PNA, galactose-binding lectin; open qu 99.97
1fny_A 237 BARK lectin, BARK agglutinin I,polypeptide A; legu 99.96
1gzc_A 239 Erythrina crista-galli lectin; carbohydrate, sugar 99.96
2eig_A 234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 99.96
1sbf_A 253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 99.96
1fx5_A 242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 99.96
1f9k_A 238 Acidic lectin; legume lectin, glycosylated protein 99.96
1wbf_A 242 Protein (agglutinin); lectin (agglutinin), legume 99.96
2fmd_A 240 Lectin, agglutinin, BMA; legume lectin, beta sandw 99.96
1avb_A 226 Arcelin-1; lectin-like glycoprotein, plant defense 99.96
1g7y_A 253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 99.96
1n47_A 233 Isolectin B4; cancer antigen, vicia villosa lectin 99.96
2bqp_A 234 Protein (PEA lectin); D-glucopyranose complex, sug 99.96
1fat_A 252 Phytohemagglutinin-L; glycoprotein, plant defense 99.96
1hql_A 257 Lectin; xenograft antigen, sugar BI protein; HET: 99.95
1ioa_A 240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 99.95
1gsl_A 243 Griffonia simplicifolia lectin 4; glycoprotein, ma 99.95
1dhk_B 223 Bean lectin-like inhibitor, porcine pancreatic alp 99.92
2dur_A 253 VIP36;, vesicular integral-membrane protein VIP36; 99.62
1gv9_A 260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.49
2a6y_A 256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 98.98
2a6z_A 222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 98.45
2a6v_A 226 EMP46P; beta sandwich, carbohydrate binding protei 97.15
>1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
Probab=100.00  E-value=2.9e-35  Score=210.19  Aligned_cols=104  Identities=34%  Similarity=0.669  Sum_probs=92.1

Q ss_pred             ceeeEEeCCCCCCCCCCeEEE-eeeeCCCCeEEcCC-CC------CCeEEEEecCCEeecCCCCCceeeeEEEEEEEEee
Q 046456           25 SALSFNYSSFSPLSDDNITYQ-RAYPDSNRMIQLPP-NP------ETAGRATYNKPMHLWDKTTRNLADFTTHFSFVIDS   96 (138)
Q Consensus        25 ~~~sF~f~~F~~~~~~~l~l~-~A~~~~~g~L~LT~-s~------~s~Gra~Y~~Pv~lwd~~t~~~aSFsT~FsF~I~~   96 (138)
                      .+++|+|++|.++ +.+|+++ ||.+. +|.||||+ +.      +++|||+|++|||+||+ +|+++||+|+|+|+|.+
T Consensus         2 ~~~~F~f~~F~~~-~~nl~l~G~A~v~-~g~l~LT~~~~~g~~~~~s~Gra~Y~~Pv~l~d~-tg~vaSFsT~F~F~I~~   78 (113)
T 1qmo_A            2 QSLSFSFTKFDPN-QEDLIFQGHATST-NNVLQVTKLDSAGNPVSSSAGRVLYSAPLRLWED-SAVLTSFDTIINFEIST   78 (113)
T ss_dssp             EEEEEEESSCCSS-CTTEEEEETCEEE-TTEEECSCBCTTSCBCSSCEEEEEESSCEECCCT-TEEEEEEEEEEEEEEEC
T ss_pred             cceEEEcCCCCCC-CCCeEEecceEcC-CCceEeCCCCCCCcccCCcEEEEEeCCCEEeeCC-CCCEEeeEEEEEEEEec
Confidence            5789999999864 5799999 99994 49999999 53      79999999999999999 99999999999999999


Q ss_pred             CCCCCCCCccEEEeccCCCCCCCCCCCCCCeeeeecCCC
Q 046456           97 QKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKDIE  135 (138)
Q Consensus        97 ~~~~~~gdGlAF~l~p~~~~~p~~~~s~g~~LGL~n~~~  135 (138)
                      .+...+||||||+|+|..+. | .  +.||||||+|.++
T Consensus        79 ~~~~~~gdGlAF~lap~~~~-p-~--s~g~~LGL~n~~n  113 (113)
T 1qmo_A           79 PYTSRIADGLAFFIAPPDSV-I-S--YHGGFLGLFPNAN  113 (113)
T ss_dssp             SSSSCCCCEEEEEEECTTCC-C-C--CCGGGTTTCSSCC
T ss_pred             CCCCCCCCeEEEEecCCCCC-C-C--CCccccccccCCC
Confidence            87777999999999998753 4 4  7899999998753
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d1fnya_ 237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 1e-21
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 6e-21
d1dbna_ 239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 9e-21
d1v6ia_ 232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 2e-20
d1avba_ 226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 3e-20
d1g9fa_ 251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 5e-20
g2ltn.1 229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 6e-20
d1g8wa_ 233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 9e-20
d1hqla_ 236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 1e-19
d1ioaa_ 228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 1e-19
d1gzca_ 239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 3e-19
d1qnwa_ 237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 4e-19
d1g7ya_ 253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 8e-19
d1n47a_ 233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 1e-18
d1f9ka_ 234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 3e-18
d2d3sa1 237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 5e-18
d1fx5a_ 240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 6e-18
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 7e-18
g1qmo.1 230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 5e-17
d1leda_ 243 b.29.1.1 (A:) Legume lectin {West-central african 6e-16
d1ukga_ 241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 8e-15
d1gv9a_ 228 b.29.1.13 (A:) Carbohydrate-recognition domain of 1e-06
d2a6za1 221 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake 4e-05
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Black locust (Robinia pseudoacacia) [TaxId: 35938]

 Score = 84.5 bits (208), Expect = 1e-21
 Identities = 43/116 (37%), Positives = 60/116 (51%), Gaps = 12/116 (10%)

Query: 25  SALSFNYSSFSPLSDDNITYQR-AYPDSNRMIQL------PPNPETAGRATYNKPMHLWD 77
            +LSF++  F+P +   +  Q  A   S  ++QL       P+ ++ GRA Y  P  +WD
Sbjct: 2   GSLSFSFPKFAP-NQPYLINQGDALVTSTGVLQLTNVVNGVPSSKSLGRALYAAPFQIWD 60

Query: 78  KTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKD 133
            TT N+A F T F+F+I +      ADGLAFFLAP            GG LG+ KD
Sbjct: 61  STTGNVASFVTSFTFIIQAPNPATTADGLAFFLAPVDTQPLD----LGGMLGIFKD 112
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 99.98
d1dbna_ 239 Legume lectin {Maackia amurensis, leukoagglutinin 99.95
d1hqla_ 236 Legume lectin {Griffonia simplicifolia, lectin I-b 99.95
d1fx5a_ 240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 99.94
d1leda_ 243 Legume lectin {West-central african legume (Griffo 99.94
d1g9fa_ 251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 99.93
d1qnwa_ 237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 99.93
d2d3sa1 237 Legume lectin {Winged bean (Psophocarpus tetragono 99.93
d1gzca_ 239 Legume lectin {Cockspur coral tree (Erythrina cris 99.93
d1f9ka_ 234 Legume lectin {Winged bean (Psophocarpus tetragono 99.93
d1g8wa_ 233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.93
d1v6ia_ 232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 99.93
d1fnya_ 237 Legume lectin {Black locust (Robinia pseudoacacia) 99.93
d1ioaa_ 228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.92
d1avba_ 226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.92
g2ltn.1 229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 99.92
g1qmo.1 230 Legume lectin {Field bean (Dolichos lablab), Fril 99.92
d1g7ya_ 253 Legume lectin {Horse gram (Dolichos biflorus), dif 99.92
d1n47a_ 233 Legume lectin {Hairy vetch (Vicia villosa), isolec 99.91
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.9
d1ukga_ 241 Legume lectin {Bloodwood tree (Pterocarpus angolen 99.89
d1gv9a_ 228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.32
d2a6za1 221 Emp47p N-terminal domain {Baker's yeast (Saccharom 99.11
d2a6va1 218 Emp46p N-terminal domain {Baker's yeast (Saccharom 98.93
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Concanavalin A
species: Jack bean (Canavalia ensiformis) [TaxId: 3823]

Probab=99.98  E-value=1e-32  Score=216.89  Aligned_cols=109  Identities=28%  Similarity=0.533  Sum_probs=97.3

Q ss_pred             CCCceeeEEeCCCCCCCCCCeEEE-eeeeCCCCeEEcCC-C------CCCeEEEEecCCEeecCCCCCceeeeEEEEEEE
Q 046456           22 LLASALSFNYSSFSPLSDDNITYQ-RAYPDSNRMIQLPP-N------PETAGRATYNKPMHLWDKTTRNLADFTTHFSFV   93 (138)
Q Consensus        22 ~~a~~~sF~f~~F~~~~~~~l~l~-~A~~~~~g~L~LT~-s------~~s~Gra~Y~~Pv~lwd~~t~~~aSFsT~FsF~   93 (138)
                      +.+++++|+|++|+++ +.+|.++ +|.+.++|.||||+ +      .+++|||+|++||||||+ +++++||+|+|+|.
T Consensus       121 ~esn~~~F~f~~F~~~-~~nl~l~G~A~i~~~G~l~LT~~~~~~~~~~~s~Gra~y~~Pv~l~d~-t~~~~SFsT~F~F~  198 (237)
T d1nlsa_         121 HETNALHFMFNQFSKD-QKDLILQGDATTGTDGNLELTRVSSNGSPQGSSVGRALFYAPVHIWES-SAVVASFEATFTFL  198 (237)
T ss_dssp             SCEEEEEEEESCCCTT-CTTEEEEETCEEEETTEEESSCBCTTSCBCSSCEEEEEESSCEECCCT-TEEEEEEEEEEEEE
T ss_pred             cccccceEEeeecCCC-CCCEEEeeeeEecCCCcEEecCCCCCCcccCcceEEEEeCCCEEEECC-CCcEeeEEEEEEEE
Confidence            3467899999999875 7899999 99997799999998 4      567999999999999996 78999999999999


Q ss_pred             EeeCCCCCCCCccEEEeccCCCCCCCCCCCCCCeeeeecCCC
Q 046456           94 IDSQKRTICADGLAFFLAPQGAPATANDDKGGGSLGLTKDIE  135 (138)
Q Consensus        94 I~~~~~~~~gdGlAF~l~p~~~~~p~~~~s~g~~LGL~n~~~  135 (138)
                      |.+.+ ..+||||||+|+|...++|.+  +.||||||||.++
T Consensus       199 I~~~~-~~~gdG~aF~iap~~~~~p~~--~~g~~LGL~n~~n  237 (237)
T d1nlsa_         199 IKSPD-SHPADGIAFFISNIDSSIPSG--STGRLLGLFPDAN  237 (237)
T ss_dssp             CCCSS-SSCCCEEEEEEECTTCCCCTT--CCGGGTTTCSSCC
T ss_pred             EecCC-CCCCCCEEEEEeCCCCCCCCC--CCCCeeeeccCCC
Confidence            98865 458999999999988788888  9999999999874
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure