Citrus Sinensis ID: 046479


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MGRGKMVLERIQNKINRQATFAKRRDGLLKKAYELSLLCDAEVALIIFSSHGMLFEFGSNFGMAKILERYRQYCYTSQEPIDINQLEPEALFREILRLRALRESLERSQRHFLGEDLGTLGVKELQKLEKQLDKTLSLSRQRKTDLMRQHLETLQKKAHDLEEENKQLKFKLEEAIRASGADPNIAVITNHLRVHPAQQMGYNAHDRANIGAASDFVSGAISPAQGWL
ccccccHHHHccccccccccccccccccHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccc
MGRGKMVLERIQNKINRQATFAKRRDGLLKKAYELSLLCDAEVALIIFSSHGMLFEFGSNFGMAKILERYRQYCYTSQEPIDINQLEPEALFREILRLRALRESLERSQRHFLGEDLGTLGVKELQKLEKQLDKTLSLSRQRKTDLMRQHLETLQKKAHDLEEENKQLKF********************************NAHDRANIGA************QGWL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGKMVLERIQNKINRQATFAKRRDGLLKKAYELSLLCDAEVALIIFSSHGMLFEFGSNFGMAKILERYRQYCYTSQEPIDINQLEPEALFREILRLRALRESLERSQRHFLGEDLGTLGVKELQKLEKQLDKTLSLSRQRKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSGADPNIAVITNHLRVHPAQQMGYNAHDRANIGAASDFVSGAISPAQGWL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MADS-box transcription factor 6 Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time.probableQ6EU39
Agamous-like MADS-box protein AGL6 Probable transcription factor. Forms an heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.probableP29386

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K6O, chain B
Confidence level:very confident
Coverage over the Query: 1-77
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 120-168
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 82-110,122-176
View the alignment between query and template
View the model in PyMOL