Citrus Sinensis ID: 046511

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MAESEPGTPAVSTPATPGTPGGALMSAARVDSLSYERQAKSGFKCLPVTAPSSWGHTNSCSFPDIPVPNVSLTRKVGAEFVGTFILIFAATAGPIVNQKYSGAETLIGNAASHLNPSLTIAFAALRHFPWVQVPAYIMAQVSASICASFALKAVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYEKLWIFLLAPTLGALAGATTYTVVKLRDNETDPPREARSFRR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHEEEEccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHHHcccccccccccccccccc
********************************************C************NSCSFPDIPVPNVSLTRKVGAEFVGTFILIFAATAGPIVNQKYSGAETLIGNAASHLNPSLTIAFAALRHFPWVQVPAYIMAQVSASICASFALKAVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYEKLWIFLLAPTLGALAGATTYTVVKL****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESEPGTPAVSTPATPGTPGGALMSAARVDSLSYERQAKSGFKCLPVTAPSSWGHTNSCSFPDIPVPNVSLTRKVGAEFVGTFILIFAATAGPIVNQKYSGAETLIGNAASHLNPSLTIAFAALRHFPWVQVPAYIMAQVSASICASFALKAVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYEKLWIFLLAPTLGALAGATTYTVVKLRDNETDPPREARSFRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable aquaporin NIP5-1 Boric acid transporter. Low water transport activity. Plays an important role as plasma membrane boric acid channel for the boron uptake required for plant growth and development under boron limitation.confidentQ9SV84
Aquaporin NIP3-1 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.probableQ0IWF3
Aquaporin NIP3-1 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.probableQ9ATN1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B6O, chain A
Confidence level:very confident
Coverage over the Query: 68-270
View the alignment between query and template
View the model in PyMOL