Citrus Sinensis ID: 046523

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MMAGNGELSVPPGFRFHPTDEELLYYYLRKKVSFEAIDLDVIREVDLNKLEPWDLKDKCRIGSGPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIHITMANVNSSRRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLDDDEYSSSSSEVVQEDGWVVCRVFKKKNHINRSYFQSEVAHEYDQEEHIISNNNNNYIMKTSATASSAAPEPKQSRRRHLQALYHECNSSFDGSMHLPQLFSSESAVITPSFISPMISLNNMDIECSQNLLRLTTSASGSGSGLMQQAAHDQRFNGDWSFLDKLLTSHVHHSAQQQPDQINSHSKCNPSSSSTVVDHVQVASSSTHYQKFPLYYLGCDAEDIMKFSK
ccccccccccccccccccccHHHHHHHHHHHHcccccccccEEEECcccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccEEEccccccccEEEEEEEEcEEEccccccccccccEEEEccccccccccccccccccccEEEEEEEEcccccccccccccccccccccHHcccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccHHHHccccc
***********PGFRFHPTDEELLYYYLRKKVSFEAIDLDVIREVDLNKLEPWDLKDKCRIGSGPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIHITMANVNSSRRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLD************QEDGWVVCRVFKKKN******************************************************LYHECN*******HLPQLFSSESAVITPSFISP**************************************FNGDWSFLDKLLTS**************************************HYQKFPLYYLGCDAEDIMKFS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMAGNGELSVPPGFRFHPTDEELLYYYLRKKVSFEAIDLDVIREVDLNKLEPWDLKDKCRIGSGPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIHITMANVNSSRRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLDDDEYSSSSSEVVQEDGWVVCRVFKKKNHINRSYFQSEVAHEYDQEEHIISNNNNNYIMKTSATASSAAPEPKQSRRRHLQALYHECNSSFDGSMHLPQLFSSESAVITPSFISPMISLNNMDIECSQNLLRLTTSASGSGSGLMQQAAHDQRFNGDWSFLDKLLTSHVHHSAQQQPDQINSHSKCNPSSSSTVVDHVQVASSSTHYQKFPLYYLGCDAEDIMKFSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SOMBRERO Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis.probableQ9MA17

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UT7, chain A
Confidence level:very confident
Coverage over the Query: 5-148,160-171
View the alignment between query and template
View the model in PyMOL