Citrus Sinensis ID: 046527

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380
HIAHLNIHDELLPFKDVIAKVIYDKNYPRIKTVVNKVGTIANEFRVPEFEILAGEDNMVTEVKQYGATFKLDYSLVYWNSRLEHEHLRIISQFRPGETICDMFAGIGPFAIPAAQKGCIVFANDLNPDSVHYLKINAKVNKVDNYVRAYNMDAREFIRQLMTAPAGEINSESDVFNLKACGNSGIQANKKTGIENVGLDVQDKEVAGNITSNSEGLQNYCRNADASVTATKRPSDGCLEENGTTNSASGRKGKTSKRMKGSELPNTKTWEHVDHIIMNLPASALKFLDAFRGLIQRQYWKGSLPWIHCYCFIRANETEELIISEAESALNACIQDPIFHKVRNVAPNKAMFCLSFRLPEACFSAKITRSVQSAGEAMSST
cEEEECcccccccHHHHHHHHHHHcccccCEEEEEcccccccCECcccEEEEEccccEEEEEEEccEEEEEEcccEEccccHHHHHHHHHHHcccccEEEEEcccccccHHHHcccccEEEEECccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHcccccccccccCECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccHHHHHHHHHHHHcccccccEEEEEEcccccccEEEEEEEccHHHHcccccccccccccccccc
HIAHLNIHDELLPFKDVIAKVIYDKNYPRIKTVVNKVGTIANEFRVPEFEILAGEDNMVTEVKQYGATFKLDYSLVYWNSRLEHEHLRIISQFRPGETICDMFAGIGPFAIPAAQKGCIVFANDLNPDSVHYLKINAKVNKVDNYVRAYNMDAREFIRQLMTAPAGEINSESDVFNLKACGNSGIQANKKTGIENVGLDVQDKEVAGNITSNSEGLQNYCRNADASVTATKRPSDGCLEENGTTNSASGRKGKT****KGSELPNTKTWEHVDHIIMNLPASALKFLDAFRGLIQRQYWKGSLPWIHCYCFIRANETEELIISEAESALNACIQDPIFHKVRNVAPNKAMFCLSFRLPEACFSAK***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HIAHLNIHDELLPFKDVIAKVIYDKNYPRIKTVVNKVGTIANEFRVPEFEILAGEDNMVTEVKQYGATFKLDYSLVYWNSRLEHEHLRIISQFRPGETICDMFAGIGPFAIPAAQKGCIVFANDLNPDSVHYLKINAKVNKVDNYVRAYNMDAREFIRQLMTAPAGEINSESDVFNLKACGNSGIQANKKTGIENVGLDVQDKEVAGNITSNSEGLQNYCRNADASVTATKRPSDGCLEENGTTNSASGRKGKTSKRMKGSELPNTKTWEHVDHIIMNLPASALKFLDAFRGLIQRQYWKGSLPWIHCYCFIRANETEELIISEAESALNACIQDPIFHKVRNVAPNKAMFCLSFRLPEACFSAKITRSVQSAGEAMSST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA (guanine(37)-N1)-methyltransferase 2 Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding.probableF6HH45
tRNA (guanine(37)-N1)-methyltransferase 1 Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding.probableQ93YU6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YX1, chain A
Confidence level:very confident
Coverage over the Query: 1-162,271-359
View the alignment between query and template
View the model in PyMOL