Citrus Sinensis ID: 046555

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE
cccccHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHccccCEECccccccccccccHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHcccEEEEEECccccccccccccccccccEEEEEccccccccccccccccccEEEEEEEEEcHHHHHHHHHccccccEEEEccccccccccEEEEEEccccEEEEEEEEccccEEEEEcccEEEEEEccccccEEEEEccccEEEEEEcccccEEEcccccccccEEEEECcEEEEcccEEEcccccccCEEEEEEEEccccHHHHHHHHHccccccccEEEEEEEcccccHHHccccccccccEEEEEccccEEcHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEc
MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box/LRR-repeat protein At1g67190 confidentQ9ZW88

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 125-230
View the alignment between query and template
View the model in PyMOL
Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 5-82
View the alignment between query and template
View the model in PyMOL
Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 2-379
View the alignment between query and template
View the model in PyMOL
Template: 3E4G, chain A
Confidence level:probable
Coverage over the Query: 264-326,353-379,390-417
View the alignment between query and template
View the model in PyMOL