Citrus Sinensis ID: 046555

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42

MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE

cccccHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccEEEEEccccccccccccccccccEEEEEEEEEcHHHHHHHHHccccccEEEEccccccccccEEEEEEccccEEEEEEEEccccEEEEEcccEEEEEEccccccEEEEEccccEEEEEEcccccEEEcccccccccEEEEEEcEEEEcccEEEcccccccEEEEEEEEEcccHHHHHHHHHHccccccccEEEEEEEccccHHHHccccccccccEEEEEccccEEcHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEc

cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHEccccccccEEEEEccccHEEEEEEccccccccccccccccccEEEcEcEEEEcHHHHHHHHHHccHHHEEEcccHHHccccccEEEEEccccccEEEEEEEcHHHHEEEHHHHHHHcHHHccEEEEEEEccccEEEEEEccEEEEEEEccccccccEEEEcccEEEEcHHHHHHHHHHHHcHHEEEEEEEEccccEEEHHHHHHHcccccEEEEEEEcHcccEEEcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccEEEEEEEc

MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTlsfnsndwsvyhdltTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNvrttpnvnileICGRQKLEVLALAHNTitgvepnfqrfpclkslslsYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVgrgtlkhfkiddvsvihldigdtvdnleivdvssftiFWPKFYQMISRSsklkklrlwdvvfdedevldletigvcfpqlshlslsydlkdgvlhyglqgsanlenvavLELGWPVISDLFSHWVEGLlkrcpnlrRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE

MEQLPVEVIGNilsrlggarDVVIASATCKKWQEAYRKHLHtlsfnsndwSVYHDLTTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHNTItgvepnfqrFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE

MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRlwdvvfdedevldleTIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE

*****VEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQF***

*EQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		418	2.2.26 [Sep-21-2011]
Q9ZW88		419	F-box/LRR-repeat protein	yes	no	1.0	0.997	0.773	0.0
Q9SAC4		418	F-box protein At1g10780 O	no	no	0.423	0.423	0.248	6e-06

>sp\|Q9ZW88\|FBL34_ARATH F-box/LRR-repeat protein At1g67190 OS=Arabidopsis thaliana GN=At1g67190 PE=2 SV=1	Back alignment and function desciption

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/419 (77%), Positives = 368/419 (87%), Gaps = 1/419 (0%)

Query: 1   MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTR 60
           M+ LPVEVIGNILSRLGGARDVVIASATC+KW+EA RKHL TLSFNS DW  Y DLTT R
Sbjct: 1   MDYLPVEVIGNILSRLGGARDVVIASATCRKWREACRKHLQTLSFNSADWPFYRDLTTNR 60

Query: 61  LEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNIL 120
           LEILITQTIFQT GLQGLSI+MDD ++FSA+TVIAWLMYTR+TLRRL YNVRTTPNVNIL
Sbjct: 61  LEILITQTIFQTMGLQGLSIMMDDANKFSAATVIAWLMYTRDTLRRLSYNVRTTPNVNIL 120

Query: 121 EICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILE 180
           EICGRQKLE L LAHN+ITGVEP+FQRFPCLKSLSLSYVSISALDL+LLL+AC  IE LE
Sbjct: 121 EICGRQKLEALVLAHNSITGVEPSFQRFPCLKSLSLSYVSISALDLNLLLSACPMIESLE 180

Query: 181 LVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGR 240
           LVS EIAM DAQVT+EL+SPTLKS+Y + ISLDKFILEADSIE LH+KDC LELFEL+G 
Sbjct: 181 LVSLEIAMSDAQVTIELSSPTLKSVYFDGISLDKFILEADSIEFLHMKDCVLELFELIGN 240

Query: 241 GTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDV-V 299
           GTLKHFK+DDVSVIHLDI +T ++LE+VDV+ FT+ WPKFYQMISRS KLKKLRLWDV  
Sbjct: 241 GTLKHFKLDDVSVIHLDIMETSESLEVVDVNHFTMVWPKFYQMISRSQKLKKLRLWDVVF 300

Query: 300 FDEDEVLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLF 359
            D+DE++D+E+I   F  L+HLSLSYDLKDG  HY LQG+  LENV VLELGW VI+D+F
Sbjct: 301 DDDDEIIDVESIAAGFSHLTHLSLSYDLKDGAAHYSLQGTTQLENVTVLELGWTVINDVF 360

Query: 360 SHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE 418
           S WVE LL+RCPNL++L+I+GV+SE KT  +C +LA FT SIVQLMRKY+HVEVQF+YE
Sbjct: 361 SIWVEELLRRCPNLKKLIIYGVVSETKTQGDCQILATFTWSIVQLMRKYIHVEVQFEYE 419

Arabidopsis thaliana (taxid: 3702)

>sp\|Q9SAC4\|FB2_ARATH F-box protein At1g10780 OS=Arabidopsis thaliana GN=At1g10780 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		418
255565615		419	conserved hypothetical protein [Ricinus	1.0	0.997	0.852	0.0
224104853		419	predicted protein [Populus trichocarpa]	1.0	0.997	0.852	0.0
224131836		419	predicted protein [Populus trichocarpa]	1.0	0.997	0.837	0.0
356539262		419	PREDICTED: F-box/LRR-repeat protein At1g	1.0	0.997	0.789	0.0
356542750		419	PREDICTED: F-box/LRR-repeat protein At1g	1.0	0.997	0.789	0.0
357471657		420	F-box/LRR-repeat protein [Medicago trunc	1.0	0.995	0.785	0.0
147805357		421	hypothetical protein VITISV_009884 [Viti	1.0	0.992	0.769	0.0
225440902		421	PREDICTED: F-box/LRR-repeat protein At1g	1.0	0.992	0.760	0.0
15220367		419	F-box/LRR-repeat protein [Arabidopsis th	1.0	0.997	0.773	0.0
297838455		419	F-box family protein [Arabidopsis lyrata	1.0	0.997	0.770	0.0

>gi\|255565615\|ref\|XP_002523797.1\| conserved hypothetical protein [Ricinus communis] gi\|223536885\|gb\|EEF38523.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/419 (85%), Positives = 395/419 (94%), Gaps = 1/419 (0%)

Query: 1   MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTR 60
           ME LPVEVIGNILS LGGARDVVIASATC+KW+EA R+HLHTLSFNSNDW VYHDLTT+R
Sbjct: 1   MEHLPVEVIGNILSHLGGARDVVIASATCRKWREACRRHLHTLSFNSNDWPVYHDLTTSR 60

Query: 61  LEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNIL 120
           LEILITQTIFQT+GLQGL+ILMDDV+EFSASTVIAWLMYTRETLRRL+YNVRTTPNVNIL
Sbjct: 61  LEILITQTIFQTTGLQGLTILMDDVEEFSASTVIAWLMYTRETLRRLFYNVRTTPNVNIL 120

Query: 121 EICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILE 180
           EICGRQKLE L L+HN+ITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTAC KIE+LE
Sbjct: 121 EICGRQKLETLELSHNSITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACPKIELLE 180

Query: 181 LVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGR 240
           L++PEIAM DAQVT+EL+SPTLKS+YVEAISLDKFILEADSIE LHLKDCALELFEL+G+
Sbjct: 181 LINPEIAMSDAQVTIELSSPTLKSVYVEAISLDKFILEADSIECLHLKDCALELFELIGK 240

Query: 241 GTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRLWDVVF 300
           G LKHFKIDDVSVIHLDIG+TVDNLEIVDVS+FTI WPKFYQ+IS+SSKL++LRLWDVVF
Sbjct: 241 GNLKHFKIDDVSVIHLDIGETVDNLEIVDVSNFTIIWPKFYQLISKSSKLRRLRLWDVVF 300

Query: 301 DEDE-VLDLETIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLF 359
           D+D+ ++DLETI V FPQLSHLSLSYDL+DGVL YGLQGS+NL NV VLELGW VI+DLF
Sbjct: 301 DDDDGIVDLETIAVYFPQLSHLSLSYDLRDGVLQYGLQGSSNLVNVVVLELGWTVINDLF 360

Query: 360 SHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE 418
           SHWVEGLLKRCPNLR+LVI+GV+SE K+ EEC +LA FTSSIVQLMRKY +V+VQF YE
Sbjct: 361 SHWVEGLLKRCPNLRKLVIYGVVSEAKSQEECQMLANFTSSIVQLMRKYTNVDVQFQYE 419

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224104853\|ref\|XP_002313592.1\| predicted protein [Populus trichocarpa] gi\|222850000\|gb\|EEE87547.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224131836\|ref\|XP_002328120.1\| predicted protein [Populus trichocarpa] gi\|222837635\|gb\|EEE76000.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356539262\|ref\|XP_003538118.1\| PREDICTED: F-box/LRR-repeat protein At1g67190-like [Glycine max]	Back alignment and taxonomy information

>gi\|356542750\|ref\|XP_003539828.1\| PREDICTED: F-box/LRR-repeat protein At1g67190-like isoform 1 [Glycine max] gi\|356542752\|ref\|XP_003539829.1\| PREDICTED: F-box/LRR-repeat protein At1g67190-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|357471657\|ref\|XP_003606113.1\| F-box/LRR-repeat protein [Medicago truncatula] gi\|355507168\|gb\|AES88310.1\| F-box/LRR-repeat protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147805357\|emb\|CAN71956.1\| hypothetical protein VITISV_009884 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225440902\|ref\|XP_002282758.1\| PREDICTED: F-box/LRR-repeat protein At1g67190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi|15220367|ref|NP_176890.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|334183703|ref|NP_001185338.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75268097|sp|Q9ZW88.1|FBL34_ARATH RecName: Full=F-box/LRR-repeat protein At1g67190 gi|4204283|gb|AAD10664.1| Hypothetical protein [Arabidopsis thaliana] gi|332196489|gb|AEE34610.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|332196490|gb|AEE34611.1| F-box/LRR-repeat protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297838455\|ref\|XP_002887109.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi\|297332950\|gb\|EFH63368.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		418
TAIR\|locus:2033696		419	AT1G67190 "AT1G67190" [Arabido	1.0	0.997	0.751	3.8e-165
TAIR\|locus:2019978		418	AT1G10780 "AT1G10780" [Arabido	0.667	0.667	0.211	4e-07
TAIR\|locus:2145279		481	AT5G25850 "AT5G25850" [Arabido	0.562	0.488	0.256	0.00011

TAIR\|locus:2033696 AT1G67190 "AT1G67190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1607 (570.8 bits), Expect = 3.8e-165, P = 3.8e-165
 Identities = 315/419 (75%), Positives = 355/419 (84%)

Query:     1 MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTR 60
             M+ LPVEVIGNILSRLGGARDVVIASATC+KW+EA RKHL TLSFNS DW  Y DLTT R
Sbjct:     1 MDYLPVEVIGNILSRLGGARDVVIASATCRKWREACRKHLQTLSFNSADWPFYRDLTTNR 60

Query:    61 LEILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNIL 120
             LEILITQTIFQT GLQGLSI+MDD ++FSA+TVIAWLMYTR+TLRRL YNVRTTPNVNIL
Sbjct:    61 LEILITQTIFQTMGLQGLSIMMDDANKFSAATVIAWLMYTRDTLRRLSYNVRTTPNVNIL 120

Query:   121 EICGRQKLEVLALAHNTITGVEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILE 180
             EICGRQKLE L LAHN+ITGVEP+FQRFPCLKSLSLSYVSISALDL+LLL+AC  IE LE
Sbjct:   121 EICGRQKLEALVLAHNSITGVEPSFQRFPCLKSLSLSYVSISALDLNLLLSACPMIESLE 180

Query:   181 LVSPEIAMLDAQVTVELTSPTLKSIYVEAISLDKFILEADSIERLHLKDCALELFELVGR 240
             LVS EIAM DAQVT+EL+SPTLKS+Y + ISLDKFILEADSIE LH+KDC LELFEL+G 
Sbjct:   181 LVSLEIAMSDAQVTIELSSPTLKSVYFDGISLDKFILEADSIEFLHMKDCVLELFELIGN 240

Query:   241 GTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFTIFWPKFYQMISRSSKLKKLRX-XXXX 299
             GTLKHFK+DDVSVIHLDI +T ++LE+VDV+ FT+ WPKFYQMISRS KLKKLR      
Sbjct:   241 GTLKHFKLDDVSVIHLDIMETSESLEVVDVNHFTMVWPKFYQMISRSQKLKKLRLWDVVF 300

Query:   300 XXXXXXXXXXTIGVCFPQLSHLSLSYDLKDGVLHYGLQGSANLENVAVLELGWPVISDLF 359
                       +I   F  L+HLSLSYDLKDG  HY LQG+  LENV VLELGW VI+D+F
Sbjct:   301 DDDDEIIDVESIAAGFSHLTHLSLSYDLKDGAAHYSLQGTTQLENVTVLELGWTVINDVF 360

Query:   360 SHWVEGLLKRCPNLRRLVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDYE 418
             S WVE LL+RCPNL++L+I+GV+SE KT  +C +LA FT SIVQLMRKY+HVEVQF+YE
Sbjct:   361 SIWVEELLRRCPNLKKLIIYGVVSETKTQGDCQILATFTWSIVQLMRKYIHVEVQFEYE 419

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:2019978 AT1G10780 "AT1G10780" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2145279 AT5G25850 "AT5G25850" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9ZW88	FBL34_ARATH	No assigned EC number	0.7732	1.0	0.9976	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		418
KOG4341		483	consensus F-box protein containing LRR [General fu	99.85
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.63
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.63
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.53
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.5
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.47
PF12937		47	F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B	98.43
KOG4341		483	consensus F-box protein containing LRR [General fu	98.37
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.28
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.28
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.16
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.12
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.06
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.03
PF00646		48	F-box: F-box domain; InterPro: IPR001810 The F-box	97.83
PLN03210		1153	Resistant to P. syringae 6; Provisional	97.76
smart00256		41	FBOX A Receptor for Ubiquitination Targets.	97.69
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.63
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	97.54
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.46
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.37
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.32
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.29
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.24
PF07723		26	LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le	97.2
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.18
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.17
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.98
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	96.91
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.84
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	96.71
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	96.63
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.08
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	95.8
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.51
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	95.42
KOG2982		418	consensus Uncharacterized conserved protein [Funct	95.33
KOG3864		221	consensus Uncharacterized conserved protein [Funct	95.13
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	95.09
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	95.06
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	94.99
PLN03215		373	ascorbic acid mannose pathway regulator 1; Provisi	93.88
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	93.87
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	93.5
KOG0617		264	consensus Ras suppressor protein (contains leucine	92.8
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	92.32
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	92.21
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	91.51
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	90.72
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	90.33
KOG2997		366	consensus F-box protein FBX9 [General function pre	90.33
PLN03150		623	hypothetical protein; Provisional	88.47
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	88.32
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	87.71
KOG3864		221	consensus Uncharacterized conserved protein [Funct	86.37
KOG0617		264	consensus Ras suppressor protein (contains leucine	85.58
PLN03150		623	hypothetical protein; Provisional	84.9
PRK15386		426	type III secretion protein GogB; Provisional	83.26
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	83.01
smart00579		72	FBD domain in FBox and BRCT domain containing plan	82.88

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

Probab=99.85  E-value=8.5e-24  Score=198.68  Aligned_cols=360  Identities=22%  Similarity=0.306  Sum_probs=200.2

Q ss_pred             CCcHHHHHHHHccCCccceeeecccccchHHHHHccCC--CcEEeecCCCccccccchhHHHHHHHHHHhcCCC-eeeEE
Q 046555            3 QLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHL--HTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSG-LQGLS   79 (418)
Q Consensus         3 ~LPdelL~~Ils~L~a~rt~vls~~vcrrWr~lw~~~~--~~l~f~~~~~~~~~~~~~~~~~~~v~~~l~~~~~-l~~l~   79 (418)
                      .||.|++.+|||+|+ +.+...++++|+-|..+.-...  ..++  -.+++.  |...    ..|..++.+..| +++++
T Consensus        74 ~LPpEl~lkvFS~LD-tksl~r~a~~c~~~n~~AlD~~~~q~id--L~t~~r--Dv~g----~VV~~~~~Rcgg~lk~LS  144 (483)
T KOG4341|consen   74 SLPPELLLKVFSMLD-TKSLCRAAQCCTMWNKLALDGSCWQHID--LFTFQR--DVDG----GVVENMISRCGGFLKELS  144 (483)
T ss_pred             cCCHHHHHHHHHHHh-HHHHHHHHHHHHHhhhhhhccccceeee--hhcchh--cCCC----cceehHhhhhcccccccc
Confidence            599999999999999 5688889999999998742211  0011  011111  1111    123333344455 88888


Q ss_pred             EEecCCCCCChHHHHHHHHHhhCCceEEEEeecCCCCccccccccccceeEEEEece-EecC--CCCCCccccccceeEE
Q 046555           80 ILMDDVDEFSASTVIAWLMYTRETLRRLYYNVRTTPNVNILEICGRQKLEVLALAHN-TITG--VEPNFQRFPCLKSLSL  156 (418)
Q Consensus        80 l~~~~~~~~~~~~v~~wl~~~~~~l~~L~l~~~~~~~~~~~~~~~~~~L~~L~L~~~-~l~~--~~~~~~~~p~L~~L~L  156 (418)
                      ++....-.  ...+.                        .+. --||+++.|++.+| .+++  ....+..|+.|+.|.|
T Consensus       145 lrG~r~v~--~sslr------------------------t~~-~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L  197 (483)
T KOG4341|consen  145 LRGCRAVG--DSSLR------------------------TFA-SNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNL  197 (483)
T ss_pred             ccccccCC--cchhh------------------------HHh-hhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhh
Confidence            87632111  11111                        111 11355555555555 3433  1123445555666666


Q ss_pred             eeE-EecHHHHHHHHHcCcccceeeecCCcccccccceeEEecCCcccEEEEEee------ccceEEEeCCCccEEEeec
Q 046555          157 SYV-SISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLKSIYVEAI------SLDKFILEADSIERLHLKD  229 (418)
Q Consensus       157 ~~v-~~~~~~l~~ll~~cp~Le~L~l~~~~~~~~~~~~~~~i~~~~L~~L~l~~~------~~~~~~~~~P~L~~L~l~~  229 (418)
                      ..| .+++..++.+..+||+|++|++++|.-...++...+.--...++.+...++      .+..+.-.+|.+.++++..
T Consensus       198 ~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~  277 (483)
T KOG4341|consen  198 HSCSSITDVSLKYLAEGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQH  277 (483)
T ss_pred             cccchhHHHHHHHHHHhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhh
Confidence            553 355555555556666666666655432212221111111112333322222      0111112233344444333


Q ss_pred             cceee-EE--Eec--CCceeEEEeccee-EE---eeccCCCcCCceeEEeeccccchHHHHHhhhc-CCCccEEEEcccc
Q 046555          230 CALEL-FE--LVG--RGTLKHFKIDDVS-VI---HLDIGDTVDNLEIVDVSSFTIFWPKFYQMISR-SSKLKKLRLWDVV  299 (418)
Q Consensus       230 ~~~~~-~~--~~~--~~~L~~l~l~~~~-~~---~l~i~~~~~~L~~l~l~~~~~~~~~~~~~l~~-~~~L~~L~L~~~~  299 (418)
                      |..-+ ..  .+.  ...++.+...... +.   ...+++..++|+.+.+..+....+..+.++++ ++.|+.|.+.++.
T Consensus       278 c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~  357 (483)
T KOG4341|consen  278 CNQLTDEDLWLIACGCHALQVLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECG  357 (483)
T ss_pred             hccccchHHHHHhhhhhHhhhhcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccc
Confidence            31100 00  000  0111111111110 00   12457788999999999998888888888865 5689999887765


Q ss_pred             cCccccccHhHHhhcCCCCceeeeeee---cccceecccccCCCCcceEEEEecCCc-ccccchHHHHHHHHhcCcccce
Q 046555          300 FDEDEVLDLETIGVCFPQLSHLSLSYD---LKDGVLHYGLQGSANLENVAVLELGWP-VISDLFSHWVEGLLKRCPNLRR  375 (418)
Q Consensus       300 ~~~~~~~~~~~l~~~fp~L~~L~l~~~---~~~~~l~~~l~~~~~Le~l~vl~l~~~-~~~d~~~~~l~~ll~~c~~Lk~  375 (418)
                      ...+.  .+..+...+|.|+.|+++++   .++|..+..- ....++.+.+++++.+ .+.|.    ..+.+..|++||+
T Consensus       358 ~~~d~--tL~sls~~C~~lr~lslshce~itD~gi~~l~~-~~c~~~~l~~lEL~n~p~i~d~----~Le~l~~c~~Ler  430 (483)
T KOG4341|consen  358 LITDG--TLASLSRNCPRLRVLSLSHCELITDEGIRHLSS-SSCSLEGLEVLELDNCPLITDA----TLEHLSICRNLER  430 (483)
T ss_pred             eehhh--hHhhhccCCchhccCChhhhhhhhhhhhhhhhh-ccccccccceeeecCCCCchHH----HHHHHhhCcccce
Confidence            44222  35667889999999999975   3454443222 2234678888888754 45552    4566889999999


Q ss_pred             EEEeeeeeecccchhhhhhHHHHHHHHHHhHhcceeEEEEee
Q 046555          376 LVIFGVISEIKTHEECLLLAKFTSSIVQLMRKYLHVEVQFDY  417 (418)
Q Consensus       376 L~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~  417 (418)
                      ++++          +|+.+++  ++|.+++.+.||++||+||
T Consensus       431 i~l~----------~~q~vtk--~~i~~~~~~lp~i~v~a~~  460 (483)
T KOG4341|consen  431 IELI----------DCQDVTK--EAISRFATHLPNIKVHAYF  460 (483)
T ss_pred             eeee----------chhhhhh--hhhHHHHhhCccceehhhc
Confidence            8887          6887777  5999999999999999998

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>smart00256 FBOX A Receptor for Ubiquitination Targets	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG2997 consensus F-box protein FBX9 [General function prediction only]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>smart00579 FBD domain in FBox and BRCT domain containing plant proteins	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		418
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-15
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-14
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-08
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	6e-04

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

 Score = 76.5 bits (188), Expect = 3e-15
 Identities = 58/408 (14%), Positives = 128/408 (31%), Gaps = 36/408 (8%)

Query: 2   EQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRL 61
                +VI  +++ +   +D   AS  C++W +   +    ++  +  ++   D  + R 
Sbjct: 14  VATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTM-ALCYTATPDRLSRRF 72

Query: 62  EILITQTIFQTSGLQGLSILMDDVDEFSASTVIAWLMYTRE-TLRRLYYNVRTTPNVNIL 120
             L +  +         +++ ++   +    V       R+         + +  +++ L
Sbjct: 73  PNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRL 132

Query: 121 EICGRQKLEVLALAHN---TITGVEPNFQRFPCLKSLSLSY---VSISALDLSLLLTACQ 174
                  LE L L      T  G+         +K+L +            L  L     
Sbjct: 133 AKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNT 192

Query: 175 KIEILELVSPEIAMLDAQVTVELT--SPTLKSIYV---EAISLDKFILEADSIERLHLKD 229
            +E+L     E A +  +    +     +L S+ V   E + L  F   A ++E      
Sbjct: 193 SLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGS 252

Query: 230 C------ALELFELVGRGTLKHFKIDDVSVIHLD-IGDTVDNLEIVDVSSFTIFWPKFYQ 282
                    +   LV    L    +  +    +  +      +  +D+    +       
Sbjct: 253 LNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCT 312

Query: 283 MISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSY--DLKDGVLHYGLQGSA 340
           +I +   L+ L   +V+ D      LE +     QL  L +    D +      GL    
Sbjct: 313 LIQKCPNLEVLETRNVIGDRG----LEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQR 368

Query: 341 NLENVA-------VLELGWPVISDLFSHWVEGLLKRCPNLRRLVIFGV 381
            L  +A        + +    I++     +E +     NL    +  +
Sbjct: 369 GLIALAQGCQELEYMAVYVSDITNE---SLESIGTYLKNLCDFRLVLL 413

PyMOL of 3ogk

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		418
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.83
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.83
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.75
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.21
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.15
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.15
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.14
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.03
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.02
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.02
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.96
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	98.94
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.93
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.92
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.92
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.91
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	98.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.9
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	98.9
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.89
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.88
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.88
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.87
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.86
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	98.85
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.82
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.82
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.82
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.82
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.81
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.81
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	98.8
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.79
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.79
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.79
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.78
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.76
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.74
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.73
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.71
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.7
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	98.7
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.7
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.68
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.66
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.65
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.64
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.62
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.61
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.6
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.59
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.59
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.59
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.58
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.57
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.56
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.56
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.53
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.52
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.5
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.5
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.49
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.49
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.49
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.48
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.47
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.47
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.46
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.45
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.44
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	98.44
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	98.43
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.43
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.42
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.41
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.41
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.39
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.36
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.36
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.31
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.31
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.31
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.27
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.21
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.18
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.18
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.17
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.15
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.13
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.12
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.09
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.01
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	97.99
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	97.96
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	97.96
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	97.95
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	97.95
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	97.94
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.93
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	97.89
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	97.85
3m19_A		251	Variable lymphocyte receptor A diversity region; a	97.85
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	97.81
2e31_A		297	FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui	97.75
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	97.75
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	97.73
3m19_A		251	Variable lymphocyte receptor A diversity region; a	97.71
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	97.7
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	97.66
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	97.66
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	97.53
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	97.36
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.23
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.23
3l2o_B		312	F-box only protein 4; small G protein fold, UBL co	97.21
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.19
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.12
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	97.11
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.11
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	97.09
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.08
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.01
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.01
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	96.97
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	96.95
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	96.93
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	96.91
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	96.9
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	96.86
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	96.78
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	96.76
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	96.75
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	96.73
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	96.71
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	96.69
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	96.53
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	96.41
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	96.35
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	96.15
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	96.11
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	95.89
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	95.79
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	95.4
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	95.38
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	95.27
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	95.05
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	95.03
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	94.72
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	94.6
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	93.82
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	92.98
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	91.84
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	90.15
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	89.79
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	87.13
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	84.46

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

Probab=99.83  E-value=1.5e-21  Score=202.06  Aligned_cols=70  Identities=17%  Similarity=0.222  Sum_probs=46.6

Q ss_pred             CCCCcHHHHHHHHccCCccceeeecccccchHHHHHccCCCcEEeecCCCccccccchhHHHHHHHHHHhcCCCeeeEEE
Q 046555            1 MEQLPVEVIGNILSRLGGARDVVIASATCKKWQEAYRKHLHTLSFNSNDWSVYHDLTTTRLEILITQTIFQTSGLQGLSI   80 (418)
Q Consensus         1 is~LPdelL~~Ils~L~a~rt~vls~~vcrrWr~lw~~~~~~l~f~~~~~~~~~~~~~~~~~~~v~~~l~~~~~l~~l~l   80 (418)
                      ++.||||+|.+||++||..++.+.++.|||||+++.......+++....    . ..+       .+++.+.+.++++.+
T Consensus         6 ~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~----~-~~~-------~~~~~~~~~L~~L~L   73 (594)
T 2p1m_B            6 ALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCY----A-VSP-------ATVIRRFPKVRSVEL   73 (594)
T ss_dssp             ----CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTT----S-SCH-------HHHHHHCTTCCEEEE
T ss_pred             hhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeecccc----c-cCH-------HHHHhhCCCceEEec
Confidence            5789999999999999966888999999999998843222345543311    1 111       134556788999998


Q ss_pred             Ee
Q 046555           81 LM   82 (418)
Q Consensus        81 ~~   82 (418)
                      ..
T Consensus        74 ~~   75 (594)
T 2p1m_B           74 KG   75 (594)
T ss_dssp             EC
T ss_pred             cC
Confidence            86

PyMOL of 2p1m

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		418
d1fs1a1		41	a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [	0.003

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41	Back information, alignment and structure


class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 33.1 bits (76), Expect = 0.003
 Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 2  EQLPVEVIGNILSRLGGARDVVIASATCKKWQEA 35
          + LP E++  I S L    +++  S  CK+W   
Sbjct: 2  DSLPDELLLGIFSCL-CLPELLKVSGVCKRWYRL 34

PyMOL of d1fs1a1

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		418
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.23
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.21
d1fs1a1		41	Skp2 {Human (Homo sapiens) [TaxId: 9606]}	98.71
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.61
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.4
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.4
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.33
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.28
d2ovrb1		102	F-box/WD repeat-containing protein 7, FBXW7 {Human	98.23
d1nexb1		100	Cdc4 F-box and linker domains {Baker's yeast (Sacc	98.17
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.14
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.11
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.01
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.01
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	97.95
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	97.88
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	97.82
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.72
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	97.68
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	97.66
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	97.66
d1p22a1		118	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	97.58
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	97.39
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	97.34
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	97.18
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	97.17
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.05
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.05
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	96.9
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	96.88
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	96.86
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.77
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	96.73
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	96.5
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	96.5
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.43
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	96.4
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	95.97
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	95.9
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	94.26
d2ifga3		156	High affinity nerve growth factor receptor, N-term	94.23
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	93.77
d2ifga3		156	High affinity nerve growth factor receptor, N-term	91.8
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	90.78
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	89.36

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.23  E-value=1.1e-13  Score=127.82  Aligned_cols=201  Identities=17%  Similarity=0.196  Sum_probs=99.2

Q ss_pred             cceeEEEEeceEecC--CCCCCccccccceeEEeeEEecHHHHHHHHHcCcccceeeecCCcccccccceeEEecCCccc
Q 046555          126 QKLEVLALAHNTITG--VEPNFQRFPCLKSLSLSYVSISALDLSLLLTACQKIEILELVSPEIAMLDAQVTVELTSPTLK  203 (418)
Q Consensus       126 ~~L~~L~L~~~~l~~--~~~~~~~~p~L~~L~L~~v~~~~~~l~~ll~~cp~Le~L~l~~~~~~~~~~~~~~~i~~~~L~  203 (418)
                      .+|++|+|++|.+++  .......|++|++|+|.++.+++..+.. +..||+|+.|++++|...++.+.           
T Consensus        46 ~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~-l~~~~~L~~L~Ls~c~~itd~~l-----------  113 (284)
T d2astb2          46 FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNT-LAKNSNLVRLNLSGCSGFSEFAL-----------  113 (284)
T ss_dssp             BCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHH-HTTCTTCSEEECTTCBSCCHHHH-----------
T ss_pred             CCCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHH-HhcCCCCcCcccccccccccccc-----------
Confidence            456666666665543  1122445666666666666666555554 34566666666665322111111           


Q ss_pred             EEEEEeeccceEEEeCCCccEEEeeccceeeEEEecCCceeEEEecceeEEeeccCCCcCCceeEEeeccc-cchHH-HH
Q 046555          204 SIYVEAISLDKFILEADSIERLHLKDCALELFELVGRGTLKHFKIDDVSVIHLDIGDTVDNLEIVDVSSFT-IFWPK-FY  281 (418)
Q Consensus       204 ~L~l~~~~~~~~~~~~P~L~~L~l~~~~~~~~~~~~~~~L~~l~l~~~~~~~l~i~~~~~~L~~l~l~~~~-~~~~~-~~  281 (418)
                               ..+.-.+|+|++|++++|..               +++.++. ..+....++|+.+.++++. ...+. +.
T Consensus       114 ---------~~l~~~~~~L~~L~ls~c~~---------------~~~~~~~-~~~~~~~~~L~~L~l~~~~~~i~~~~l~  168 (284)
T d2astb2         114 ---------QTLLSSCSRLDELNLSWCFD---------------FTEKHVQ-VAVAHVSETITQLNLSGYRKNLQKSDLS  168 (284)
T ss_dssp             ---------HHHHHHCTTCCEEECCCCTT---------------CCHHHHH-HHHHHSCTTCCEEECCSCGGGSCHHHHH
T ss_pred             ---------chhhHHHHhccccccccccc---------------cccccch-hhhcccccccchhhhccccccccccccc
Confidence                     11111256777777766531               1110000 0011234566666666542 22222 33


Q ss_pred             HhhhcCCCccEEEEcccccCccccccHhHHhhcCCCCceeeeeeec--ccceecccccCCCCcceEEEEecCCcccccch
Q 046555          282 QMISRSSKLKKLRLWDVVFDEDEVLDLETIGVCFPQLSHLSLSYDL--KDGVLHYGLQGSANLENVAVLELGWPVISDLF  359 (418)
Q Consensus       282 ~~l~~~~~L~~L~L~~~~~~~~~~~~~~~l~~~fp~L~~L~l~~~~--~~~~l~~~l~~~~~Le~l~vl~l~~~~~~d~~  359 (418)
                      .....+++|++|++.++....+..  +..+. .+|+|++|.++++.  .+..+ ..+..+++|+.+   ++..+ ++|. 
T Consensus       169 ~l~~~~~~L~~L~L~~~~~itd~~--~~~l~-~~~~L~~L~L~~C~~i~~~~l-~~L~~~~~L~~L---~l~~~-~~d~-  239 (284)
T d2astb2         169 TLVRRCPNLVHLDLSDSVMLKNDC--FQEFF-QLNYLQHLSLSRCYDIIPETL-LELGEIPTLKTL---QVFGI-VPDG-  239 (284)
T ss_dssp             HHHHHCTTCSEEECTTCTTCCGGG--GGGGG-GCTTCCEEECTTCTTCCGGGG-GGGGGCTTCCEE---ECTTS-SCTT-
T ss_pred             ccccccccccccccccccCCCchh--hhhhc-ccCcCCEEECCCCCCCChHHH-HHHhcCCCCCEE---eeeCC-CCHH-
Confidence            345667888888876654332211  22232 46888888888752  22222 223445555554   44322 3442 


Q ss_pred             HHHHHHHHhcCcccc
Q 046555          360 SHWVEGLLKRCPNLR  374 (418)
Q Consensus       360 ~~~l~~ll~~c~~Lk  374 (418)
                        .+..+.+.||+|+
T Consensus       240 --~l~~l~~~lp~L~  252 (284)
T d2astb2         240 --TLQLLKEALPHLQ  252 (284)
T ss_dssp             --CHHHHHHHSTTSE
T ss_pred             --HHHHHHHhCcccc
Confidence              3456666777776

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure