Citrus Sinensis ID: 046574


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MKTVGEKSECPHSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDLPRRFEFNAPLNKYNRETFYVSDPVVGYTDYPFLDTSSYVTKKKH
ccccccccccccHHHHHHHHccccEEEcccccHHHHHHHHHcccccEEEEcccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHccc
********ECPHSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDLPRRFEFNAPLNKYNRETFYVSDPVVGYTDYPFLDTSSY******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTVGEKSECPHSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDLPRRFEFNAPLNKYNRETFYVSDPVVGYTDYPFLDTSSYVTKKKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative 12-oxophytodienoate reductase 4 Putative oxophytodienoate reductase that may be involved in the biosynthesis or metabolism of oxylipin signaling molecules.probableQ69TH8
Putative 12-oxophytodienoate reductase 11 Putative oxophytodienoate reductase that may be involved in the biosynthesis or metabolism of oxylipin signaling molecules.probableB9FSC8
12-oxophytodienoate reductase 1 Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds. May be involved in the biosynthesis or metabolism of oxylipin signaling molecules. In vitro, reduces 9R,13R-12-oxophyodienoic acid (9R,13R-OPDA) to 9R,13R-OPC-8:0, but only poorly 9S,13S-OPDA, the natural precursor of jasmonic acid. Can detoxify the explosive 2,4,6-trinitrotoluene (TNT) in vitro and in vivo by catalyzing its nitroreduction to form hydroxylamino-dinitrotoluene (HADNT).probableQ8LAH7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ICP, chain A
Confidence level:very confident
Coverage over the Query: 12-94
View the alignment between query and template
View the model in PyMOL