Citrus Sinensis ID: 046574
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 104 | ||||||
| 255570937 | 278 | 12-oxophytodienoate reductase opr, putat | 0.932 | 0.348 | 0.824 | 3e-43 | |
| 147809487 | 350 | hypothetical protein VITISV_011309 [Viti | 0.923 | 0.274 | 0.822 | 1e-41 | |
| 225460240 | 379 | PREDICTED: 12-oxophytodienoate reductase | 0.903 | 0.248 | 0.840 | 2e-41 | |
| 359493353 | 361 | PREDICTED: LOW QUALITY PROTEIN: 12-oxoph | 0.923 | 0.265 | 0.822 | 2e-41 | |
| 147782387 | 367 | hypothetical protein VITISV_031221 [Viti | 0.923 | 0.261 | 0.822 | 3e-41 | |
| 225460244 | 379 | PREDICTED: 12-oxophytodienoate reductase | 0.923 | 0.253 | 0.822 | 3e-41 | |
| 147778557 | 379 | hypothetical protein VITISV_033920 [Viti | 0.903 | 0.248 | 0.829 | 1e-40 | |
| 40645459 | 375 | LEDI-5c protein [Lithospermum erythrorhi | 0.932 | 0.258 | 0.793 | 2e-40 | |
| 2232254 | 379 | old-yellow-enzyme homolog [Catharanthus | 0.923 | 0.253 | 0.791 | 7e-40 | |
| 356497438 | 371 | PREDICTED: 12-oxophytodienoate reductase | 0.903 | 0.253 | 0.797 | 8e-40 |
| >gi|255570937|ref|XP_002526420.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] gi|223534282|gb|EEF35996.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 178 bits (452), Expect = 3e-43, Method: Compositional matrix adjust.
Identities = 80/97 (82%), Positives = 88/97 (90%)
Query: 1 MKTVGEKSECPHSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDL 60
MKTVGEKSECP SLL MRKAFKGTF+ AGGYD EDGNKA+AE RADL+ +GR FLANPDL
Sbjct: 182 MKTVGEKSECPQSLLPMRKAFKGTFIAAGGYDMEDGNKAVAENRADLIAFGRLFLANPDL 241
Query: 61 PRRFEFNAPLNKYNRETFYVSDPVVGYTDYPFLDTSS 97
PRRFE NAPLNKYNRETFY+SDPV+GYTDYPFL+ S+
Sbjct: 242 PRRFELNAPLNKYNRETFYISDPVIGYTDYPFLEAST 278
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147809487|emb|CAN66656.1| hypothetical protein VITISV_011309 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225460240|ref|XP_002281119.1| PREDICTED: 12-oxophytodienoate reductase 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493353|ref|XP_002278021.2| PREDICTED: LOW QUALITY PROTEIN: 12-oxophytodienoate reductase 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147782387|emb|CAN66144.1| hypothetical protein VITISV_031221 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225460244|ref|XP_002281348.1| PREDICTED: 12-oxophytodienoate reductase 2 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147778557|emb|CAN60665.1| hypothetical protein VITISV_033920 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|40645459|dbj|BAD06575.1| LEDI-5c protein [Lithospermum erythrorhizon] | Back alignment and taxonomy information |
|---|
| >gi|2232254|gb|AAB62248.1| old-yellow-enzyme homolog [Catharanthus roseus] | Back alignment and taxonomy information |
|---|
| >gi|356497438|ref|XP_003517567.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 104 | ||||||
| TAIR|locus:2030086 | 397 | OPR1 "12-oxophytodienoate redu | 0.932 | 0.244 | 0.701 | 2.7e-36 | |
| TAIR|locus:2030096 | 374 | OPR2 "12-oxophytodienoate redu | 0.932 | 0.259 | 0.701 | 1.2e-35 | |
| UNIPROTKB|Q84QK0 | 380 | OPR1 "12-oxophytodienoate redu | 0.903 | 0.247 | 0.659 | 1.3e-31 | |
| TAIR|locus:2012285 | 324 | AT1G09400 [Arabidopsis thalian | 0.692 | 0.222 | 0.763 | 3.6e-25 | |
| UNIPROTKB|C5H429 | 387 | DBR2 "Artemisinic aldehyde Del | 0.894 | 0.240 | 0.548 | 8.7e-24 | |
| TAIR|locus:2051516 | 391 | OPR3 "oxophytodienoate-reducta | 0.740 | 0.196 | 0.610 | 4.8e-23 | |
| UNIPROTKB|Q6Z965 | 394 | OPR7 "12-oxophytodienoate redu | 0.855 | 0.225 | 0.561 | 1.4e-22 | |
| UNIPROTKB|G5EHQ2 | 409 | MGCH7_ch7g132 "12-oxophytodien | 0.778 | 0.198 | 0.476 | 2.6e-16 | |
| POMBASE|SPAC5H10.10 | 392 | SPAC5H10.10 "NADPH dehydrogena | 0.826 | 0.219 | 0.426 | 1.3e-14 | |
| POMBASE|SPAC5H10.04 | 382 | SPAC5H10.04 "NADPH dehydrogena | 0.721 | 0.196 | 0.5 | 2.6e-14 |
| TAIR|locus:2030086 OPR1 "12-oxophytodienoate reductase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 391 (142.7 bits), Expect = 2.7e-36, P = 2.7e-36
Identities = 68/97 (70%), Positives = 86/97 (88%)
Query: 1 MKTVGEKSECPHSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDL 60
MKT+GE CPH+L+ MRKAFKGTF+ AGG+ REDGN+A+++GR DLV YGR+FLANPDL
Sbjct: 301 MKTMGEVHACPHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDL 360
Query: 61 PRRFEFNAPLNKYNRETFYVSDPVVGYTDYPFLDTSS 97
P+RF+ +APLNKY+R TFY SDPVVGYTDYPFL++++
Sbjct: 361 PKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLESTA 397
|
|
| TAIR|locus:2030096 OPR2 "12-oxophytodienoate reductase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q84QK0 OPR1 "12-oxophytodienoate reductase 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012285 AT1G09400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C5H429 DBR2 "Artemisinic aldehyde Delta(11(13)) reductase" [Artemisia annua (taxid:35608)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2051516 OPR3 "oxophytodienoate-reductase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6Z965 OPR7 "12-oxophytodienoate reductase 7" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5EHQ2 MGCH7_ch7g132 "12-oxophytodienoate reductase 1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC5H10.10 SPAC5H10.10 "NADPH dehydrogenase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC5H10.04 SPAC5H10.04 "NADPH dehydrogenase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 104 | |||
| PLN02411 | 391 | PLN02411, PLN02411, 12-oxophytodienoate reductase | 2e-37 | |
| cd02933 | 338 | cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-lik | 3e-30 | |
| PRK10605 | 362 | PRK10605, PRK10605, N-ethylmaleimide reductase; Pr | 3e-19 | |
| COG1902 | 363 | COG1902, NemA, NADH:flavin oxidoreductases, Old Ye | 1e-15 | |
| pfam00724 | 336 | pfam00724, Oxidored_FMN, NADH:flavin oxidoreductas | 8e-13 | |
| cd02803 | 327 | cd02803, OYE_like_FMN_family, Old yellow enzyme (O | 1e-11 | |
| cd02932 | 336 | cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) Yqj | 6e-05 | |
| cd04733 | 338 | cd04733, OYE_like_2_FMN, Old yellow enzyme (OYE)-r | 4e-04 | |
| cd04734 | 343 | cd04734, OYE_like_3_FMN, Old yellow enzyme (OYE)-r | 0.001 |
| >gnl|CDD|178033 PLN02411, PLN02411, 12-oxophytodienoate reductase | Back alignment and domain information |
|---|
Score = 129 bits (326), Expect = 2e-37
Identities = 49/76 (64%), Positives = 62/76 (81%)
Query: 18 RKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDLPRRFEFNAPLNKYNRET 77
R+A++GTF+ +GG+ RE G +A+ +G ADLV YGR F++NPDL RF+ NAPLNKY R+T
Sbjct: 309 RRAYQGTFMCSGGFTRELGMQAVQQGDADLVSYGRLFISNPDLVLRFKLNAPLNKYIRKT 368
Query: 78 FYVSDPVVGYTDYPFL 93
FY DPVVGYTDYPFL
Sbjct: 369 FYTQDPVVGYTDYPFL 384
|
Length = 391 |
| >gnl|CDD|239243 cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|182584 PRK10605, PRK10605, N-ethylmaleimide reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224814 COG1902, NemA, NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|216083 pfam00724, Oxidored_FMN, NADH:flavin oxidoreductase / NADH oxidase family | Back alignment and domain information |
|---|
| >gnl|CDD|239201 cd02803, OYE_like_FMN_family, Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239242 cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) YqjM-like FMN binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240084 cd04733, OYE_like_2_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 2 | Back alignment and domain information |
|---|
| >gnl|CDD|240085 cd04734, OYE_like_3_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| PLN02411 | 391 | 12-oxophytodienoate reductase | 99.83 | |
| PRK10605 | 362 | N-ethylmaleimide reductase; Provisional | 99.75 | |
| COG1902 | 363 | NemA NADH:flavin oxidoreductases, Old Yellow Enzym | 99.61 | |
| cd02933 | 338 | OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind | 99.55 | |
| KOG0134 | 400 | consensus NADH:flavin oxidoreductase/12-oxophytodi | 99.54 | |
| PF00724 | 341 | Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox | 99.53 | |
| cd02929 | 370 | TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) | 99.43 | |
| cd02931 | 382 | ER_like_FMN Enoate reductase (ER)-like FMN-binding | 99.41 | |
| cd04747 | 361 | OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN | 99.4 | |
| cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN | 99.39 | |
| cd04733 | 338 | OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN | 99.39 | |
| PRK13523 | 337 | NADPH dehydrogenase NamA; Provisional | 99.36 | |
| cd02930 | 353 | DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin | 99.3 | |
| cd02803 | 327 | OYE_like_FMN_family Old yellow enzyme (OYE)-like F | 99.29 | |
| cd02932 | 336 | OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN | 99.23 | |
| cd04735 | 353 | OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN | 99.22 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 99.13 | |
| cd02801 | 231 | DUS_like_FMN Dihydrouridine synthase-like (DUS-lik | 99.05 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 99.0 | |
| PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 98.9 | |
| TIGR01037 | 300 | pyrD_sub1_fam dihydroorotate dehydrogenase (subfam | 98.88 | |
| TIGR00737 | 319 | nifR3_yhdG putative TIM-barrel protein, nifR3 fami | 98.86 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 98.86 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 98.74 | |
| PRK10415 | 321 | tRNA-dihydrouridine synthase B; Provisional | 98.7 | |
| PRK11815 | 333 | tRNA-dihydrouridine synthase A; Provisional | 98.55 | |
| PRK05286 | 344 | dihydroorotate dehydrogenase 2; Reviewed | 98.43 | |
| cd04738 | 327 | DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl | 98.42 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 98.33 | |
| TIGR00742 | 318 | yjbN tRNA dihydrouridine synthase A. Members of th | 98.25 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 98.24 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 98.24 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 98.14 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 98.12 | |
| COG0042 | 323 | tRNA-dihydrouridine synthase [Translation, ribosom | 98.12 | |
| TIGR01036 | 335 | pyrD_sub2 dihydroorotate dehydrogenase, subfamily | 98.11 | |
| cd02911 | 233 | arch_FMN Archeal FMN-binding domain. This family o | 98.11 | |
| cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like | 98.09 | |
| PF01207 | 309 | Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 | 98.02 | |
| cd04741 | 294 | DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c | 98.0 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 98.0 | |
| cd02940 | 299 | DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM | 97.95 | |
| TIGR00736 | 231 | nifR3_rel_arch TIM-barrel protein, putative. Membe | 97.93 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 97.82 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.78 | |
| cd02812 | 219 | PcrB_like PcrB_like proteins. One member of this f | 97.74 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 97.74 | |
| cd00564 | 196 | TMP_TenI Thiamine monophosphate synthase (TMP synt | 97.72 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.72 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 97.68 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 97.67 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 97.64 | |
| TIGR01768 | 223 | GGGP-family geranylgeranylglyceryl phosphate synth | 97.64 | |
| COG0107 | 256 | HisF Imidazoleglycerol-phosphate synthase [Amino a | 97.64 | |
| PRK07695 | 201 | transcriptional regulator TenI; Provisional | 97.64 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.61 | |
| PF01180 | 295 | DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP | 97.6 | |
| KOG2335 | 358 | consensus tRNA-dihydrouridine synthase [Translatio | 97.59 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 97.55 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.53 | |
| PRK04169 | 232 | geranylgeranylglyceryl phosphate synthase-like pro | 97.52 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 97.48 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 97.47 | |
| PLN02826 | 409 | dihydroorotate dehydrogenase | 97.47 | |
| cd00429 | 211 | RPE Ribulose-5-phosphate 3-epimerase (RPE). This e | 97.47 | |
| PRK00043 | 212 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 97.45 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 97.45 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 97.44 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.44 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 97.43 | |
| PRK02506 | 310 | dihydroorotate dehydrogenase 1A; Reviewed | 97.43 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 97.4 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.4 | |
| cd04726 | 202 | KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl | 97.36 | |
| TIGR01163 | 210 | rpe ribulose-phosphate 3-epimerase. This family co | 97.36 | |
| COG0167 | 310 | PyrD Dihydroorotate dehydrogenase [Nucleotide tran | 97.34 | |
| cd04730 | 236 | NPD_like 2-Nitropropane dioxygenase (NPD), one of | 97.32 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 97.28 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 97.25 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 97.23 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 97.2 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 97.17 | |
| PRK05581 | 220 | ribulose-phosphate 3-epimerase; Validated | 97.15 | |
| PRK04180 | 293 | pyridoxal biosynthesis lyase PdxS; Provisional | 97.15 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 97.12 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 97.12 | |
| COG0352 | 211 | ThiE Thiamine monophosphate synthase [Coenzyme met | 97.11 | |
| cd04727 | 283 | pdxS PdxS is a subunit of the pyridoxal 5'-phospha | 97.1 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 97.05 | |
| PF03060 | 330 | NMO: Nitronate monooxygenase; InterPro: IPR004136 | 97.04 | |
| TIGR00693 | 196 | thiE thiamine-phosphate pyrophosphorylase. This mo | 97.03 | |
| TIGR00343 | 287 | pyridoxal 5'-phosphate synthase, synthase subunit | 97.0 | |
| PRK06512 | 221 | thiamine-phosphate pyrophosphorylase; Provisional | 97.0 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 96.95 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 96.95 | |
| PLN02334 | 229 | ribulose-phosphate 3-epimerase | 96.94 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.89 | |
| TIGR02708 | 367 | L_lactate_ox L-lactate oxidase. Members of this pr | 96.85 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 96.83 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.81 | |
| PF01884 | 230 | PcrB: PcrB family; InterPro: IPR008205 This entry | 96.81 | |
| PRK07028 | 430 | bifunctional hexulose-6-phosphate synthase/ribonuc | 96.81 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 96.81 | |
| PRK07455 | 187 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 96.77 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 96.75 | |
| PRK04302 | 223 | triosephosphate isomerase; Provisional | 96.75 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 96.73 | |
| PLN02495 | 385 | oxidoreductase, acting on the CH-CH group of donor | 96.72 | |
| TIGR01769 | 205 | GGGP geranylgeranylglyceryl phosphate synthase. Th | 96.72 | |
| PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R | 96.64 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 96.64 | |
| cd04722 | 200 | TIM_phosphate_binding TIM barrel proteins share a | 96.63 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 96.58 | |
| PRK02615 | 347 | thiamine-phosphate pyrophosphorylase; Provisional | 96.57 | |
| TIGR03128 | 206 | RuMP_HxlA 3-hexulose-6-phosphate synthase. at the | 96.53 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 96.51 | |
| COG2070 | 336 | Dioxygenases related to 2-nitropropane dioxygenase | 96.48 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 96.47 | |
| PRK03512 | 211 | thiamine-phosphate pyrophosphorylase; Provisional | 96.47 | |
| PRK08883 | 220 | ribulose-phosphate 3-epimerase; Provisional | 96.45 | |
| PLN02535 | 364 | glycolate oxidase | 96.43 | |
| COG1304 | 360 | idi Isopentenyl diphosphate isomerase (BS_ypgA, MT | 96.36 | |
| cd02808 | 392 | GltS_FMN Glutamate synthase (GltS) FMN-binding dom | 96.36 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 96.33 | |
| PTZ00170 | 228 | D-ribulose-5-phosphate 3-epimerase; Provisional | 96.31 | |
| PF01070 | 356 | FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR | 96.31 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 96.3 | |
| PF04131 | 192 | NanE: Putative N-acetylmannosamine-6-phosphate epi | 96.27 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 96.25 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 96.25 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 96.24 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 96.23 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 96.21 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 96.18 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 96.18 | |
| cd04742 | 418 | NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom | 96.16 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 96.12 | |
| TIGR02814 | 444 | pfaD_fam PfaD family protein. The protein PfaD is | 96.11 | |
| PLN02979 | 366 | glycolate oxidase | 96.0 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 95.96 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 95.95 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 95.94 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 95.89 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 95.88 | |
| cd00958 | 235 | DhnA Class I fructose-1,6-bisphosphate (FBP) aldol | 95.78 | |
| TIGR01949 | 258 | AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep | 95.77 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 95.71 | |
| PLN02898 | 502 | HMP-P kinase/thiamin-monophosphate pyrophosphoryla | 95.68 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 95.67 | |
| PLN02591 | 250 | tryptophan synthase | 95.62 | |
| CHL00200 | 263 | trpA tryptophan synthase alpha subunit; Provisiona | 95.57 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 95.49 | |
| COG1646 | 240 | Predicted phosphate-binding enzymes, TIM-barrel fo | 95.46 | |
| cd00405 | 203 | PRAI Phosphoribosylanthranilate isomerase (PRAI) c | 95.42 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 95.41 | |
| PRK09517 | 755 | multifunctional thiamine-phosphate pyrophosphoryla | 95.2 | |
| PRK13307 | 391 | bifunctional formaldehyde-activating enzyme/3-hexu | 95.18 | |
| CHL00162 | 267 | thiG thiamin biosynthesis protein G; Validated | 95.12 | |
| PRK12290 | 437 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 95.06 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 95.06 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 94.93 | |
| TIGR01182 | 204 | eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho | 94.9 | |
| PF02581 | 180 | TMP-TENI: Thiamine monophosphate synthase/TENI; In | 94.85 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 94.83 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 94.8 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 94.79 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 94.65 | |
| cd01568 | 269 | QPRTase_NadC Quinolinate phosphoribosyl transferas | 94.6 | |
| PRK05718 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 94.56 | |
| PRK13125 | 244 | trpA tryptophan synthase subunit alpha; Provisiona | 94.55 | |
| COG0107 | 256 | HisF Imidazoleglycerol-phosphate synthase [Amino a | 94.38 | |
| PRK05742 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 94.31 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 94.28 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 94.23 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 94.21 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 94.17 | |
| PF00218 | 254 | IGPS: Indole-3-glycerol phosphate synthase; InterP | 94.05 | |
| PRK06806 | 281 | fructose-bisphosphate aldolase; Provisional | 93.93 | |
| PRK08005 | 210 | epimerase; Validated | 93.88 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 93.85 | |
| PRK07226 | 267 | fructose-bisphosphate aldolase; Provisional | 93.83 | |
| TIGR01740 | 213 | pyrF orotidine 5'-phosphate decarboxylase, subfami | 93.82 | |
| PF05690 | 247 | ThiG: Thiazole biosynthesis protein ThiG; InterPro | 93.7 | |
| PRK13813 | 215 | orotidine 5'-phosphate decarboxylase; Provisional | 93.66 | |
| cd01572 | 268 | QPRTase Quinolinate phosphoribosyl transferase (QA | 93.62 | |
| PRK13306 | 216 | ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; | 93.53 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 93.5 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 93.48 | |
| PRK11840 | 326 | bifunctional sulfur carrier protein/thiazole synth | 93.45 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 93.39 | |
| PRK00507 | 221 | deoxyribose-phosphate aldolase; Provisional | 93.36 | |
| COG0269 | 217 | SgbH 3-hexulose-6-phosphate synthase and related p | 93.36 | |
| PRK08072 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 93.35 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 93.32 | |
| PRK06015 | 201 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 93.28 | |
| COG3010 | 229 | NanE Putative N-acetylmannosamine-6-phosphate epim | 93.26 | |
| cd04724 | 242 | Tryptophan_synthase_alpha Ttryptophan synthase (TR | 93.2 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 93.2 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 93.19 | |
| COG0036 | 220 | Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate | 93.13 | |
| TIGR00078 | 265 | nadC nicotinate-nucleotide pyrophosphorylase. Syno | 93.05 | |
| PF01645 | 368 | Glu_synthase: Conserved region in glutamate syntha | 92.99 | |
| cd01573 | 272 | modD_like ModD; Quinolinate phosphoribosyl transfe | 92.88 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 92.84 | |
| cd00311 | 242 | TIM Triosephosphate isomerase (TIM) is a glycolyti | 92.84 | |
| PF01081 | 196 | Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 | 92.75 | |
| PRK08745 | 223 | ribulose-phosphate 3-epimerase; Provisional | 92.74 | |
| PRK08091 | 228 | ribulose-phosphate 3-epimerase; Validated | 92.45 | |
| PRK00230 | 230 | orotidine 5'-phosphate decarboxylase; Reviewed | 92.33 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 92.3 | |
| PRK14567 | 253 | triosephosphate isomerase; Provisional | 92.18 | |
| PF04309 | 175 | G3P_antiterm: Glycerol-3-phosphate responsive anti | 92.11 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 92.0 | |
| PRK13957 | 247 | indole-3-glycerol-phosphate synthase; Provisional | 91.84 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 91.82 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 91.76 | |
| PRK07315 | 293 | fructose-bisphosphate aldolase; Provisional | 91.49 | |
| PF00290 | 259 | Trp_syntA: Tryptophan synthase alpha chain; InterP | 91.29 | |
| cd02068 | 127 | radical_SAM_B12_BD B12 binding domain_like associa | 91.23 | |
| PRK05848 | 273 | nicotinate-nucleotide pyrophosphorylase; Provision | 90.92 | |
| cd04743 | 320 | NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma | 90.61 | |
| PRK14057 | 254 | epimerase; Provisional | 90.59 | |
| PTZ00333 | 255 | triosephosphate isomerase; Provisional | 90.59 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 90.58 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 90.54 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 90.54 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 90.47 | |
| PRK07428 | 288 | nicotinate-nucleotide pyrophosphorylase; Provision | 90.34 | |
| PRK07114 | 222 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 90.32 | |
| PRK13305 | 218 | sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; | 90.18 | |
| PRK09427 | 454 | bifunctional indole-3-glycerol phosphate synthase/ | 90.1 | |
| COG1954 | 181 | GlpP Glycerol-3-phosphate responsive antiterminato | 89.91 | |
| PRK14565 | 237 | triosephosphate isomerase; Provisional | 89.84 | |
| COG2022 | 262 | ThiG Uncharacterized enzyme of thiazole biosynthes | 89.84 | |
| TIGR01859 | 282 | fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, | 89.68 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 89.39 | |
| PF01081 | 196 | Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 | 89.19 | |
| TIGR00259 | 257 | thylakoid_BtpA membrane complex biogenesis protein | 89.14 | |
| PLN02460 | 338 | indole-3-glycerol-phosphate synthase | 89.09 | |
| PRK09722 | 229 | allulose-6-phosphate 3-epimerase; Provisional | 89.07 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 88.98 | |
| TIGR01182 | 204 | eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho | 88.77 | |
| PRK13802 | 695 | bifunctional indole-3-glycerol phosphate synthase/ | 88.77 | |
| PRK06015 | 201 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 88.68 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 88.53 | |
| cd01571 | 302 | NAPRTase_B Nicotinate phosphoribosyltransferase (N | 88.49 | |
| PLN02979 | 366 | glycolate oxidase | 88.46 | |
| PLN02716 | 308 | nicotinate-nucleotide diphosphorylase (carboxylati | 88.33 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 88.28 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 88.11 | |
| COG0134 | 254 | TrpC Indole-3-glycerol phosphate synthase [Amino a | 88.09 | |
| KOG1436 | 398 | consensus Dihydroorotate dehydrogenase [Nucleotide | 87.96 | |
| cd00516 | 281 | PRTase_typeII Phosphoribosyltransferase (PRTase) t | 87.58 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 87.48 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 87.41 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 87.38 | |
| KOG0538 | 363 | consensus Glycolate oxidase [Energy production and | 87.35 | |
| COG0159 | 265 | TrpA Tryptophan synthase alpha chain [Amino acid t | 87.16 | |
| PRK08385 | 278 | nicotinate-nucleotide pyrophosphorylase; Provision | 86.95 | |
| PRK00042 | 250 | tpiA triosephosphate isomerase; Provisional | 86.93 | |
| PF01729 | 169 | QRPTase_C: Quinolinate phosphoribosyl transferase, | 86.69 | |
| cd03315 | 265 | MLE_like Muconate lactonizing enzyme (MLE) like su | 86.65 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 86.56 | |
| PLN02561 | 253 | triosephosphate isomerase | 86.51 | |
| PRK06801 | 286 | hypothetical protein; Provisional | 86.5 | |
| PLN02535 | 364 | glycolate oxidase | 86.46 | |
| PF03437 | 254 | BtpA: BtpA family; InterPro: IPR005137 Photosystem | 86.4 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 86.4 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 86.35 | |
| PRK06106 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 86.23 | |
| cd03316 | 357 | MR_like Mandelate racemase (MR)-like subfamily of | 86.21 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 85.55 | |
| PRK05718 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 85.2 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 85.1 | |
| COG0800 | 211 | Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca | 85.06 | |
| PRK07896 | 289 | nicotinate-nucleotide pyrophosphorylase; Provision | 85.02 | |
| COG1058 | 255 | CinA Predicted nucleotide-utilizing enzyme related | 84.68 | |
| PRK06543 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 84.15 | |
| cd04725 | 216 | OMP_decarboxylase_like Orotidine 5'-phosphate deca | 84.12 | |
| COG1908 | 132 | FrhD Coenzyme F420-reducing hydrogenase, delta sub | 83.59 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 83.21 | |
| PRK14905 | 355 | triosephosphate isomerase/PTS system glucose/sucro | 83.17 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 83.13 | |
| PRK06559 | 290 | nicotinate-nucleotide pyrophosphorylase; Provision | 82.84 | |
| PRK07188 | 352 | nicotinate phosphoribosyltransferase; Provisional | 82.64 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 82.48 | |
| PRK06978 | 294 | nicotinate-nucleotide pyrophosphorylase; Provision | 82.35 | |
| TIGR01334 | 277 | modD putative molybdenum utilization protein ModD. | 82.18 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 82.15 | |
| PF01070 | 356 | FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR | 81.77 | |
| KOG1606 | 296 | consensus Stationary phase-induced protein, SOR/SN | 81.76 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 81.71 | |
| cd03319 | 316 | L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat | 81.42 | |
| cd00945 | 201 | Aldolase_Class_I Class I aldolases. The class I al | 81.33 | |
| PRK15492 | 260 | triosephosphate isomerase; Provisional | 81.21 | |
| PF00834 | 201 | Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam | 81.21 | |
| PRK07114 | 222 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 80.98 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 80.61 |
| >PLN02411 12-oxophytodienoate reductase | Back alignment and domain information |
|---|
Probab=99.83 E-value=2.3e-20 Score=147.72 Aligned_cols=82 Identities=60% Similarity=1.119 Sum_probs=75.1
Q ss_pred HHHHHHHHcCCeEEEeCCCCHHHHHHHHHcCCCcEEecchHHhhCCcHHHHHhhCCCCCCCCccccccCCCCCCcccCCC
Q 046574 13 SLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDLPRRFEFNAPLNKYNRETFYVSDPVVGYTDYPF 92 (104)
Q Consensus 13 ~~~~ir~~~~~pvi~~Ggi~~~~ae~~l~~g~~DlVa~gR~~lanPdl~~ri~~g~~l~~~d~~~~~~~~~~~gy~d~p~ 92 (104)
.++.||+.+++|||++|+|+++.|+++|++|.+|+|++||++|+|||||+|+++|++++++++.+||+.+...||+|||+
T Consensus 304 ~a~~ik~~v~~pvi~~G~i~~~~a~~~l~~g~aDlV~~gR~~iadPdl~~k~~~g~~l~~~~~~~~~~~~~~~gy~~~p~ 383 (391)
T PLN02411 304 LMRTLRRAYQGTFMCSGGFTRELGMQAVQQGDADLVSYGRLFISNPDLVLRFKLNAPLNKYIRKTFYTQDPVVGYTDYPF 383 (391)
T ss_pred HHHHHHHHcCCCEEEECCCCHHHHHHHHHcCCCCEEEECHHHHhCccHHHHHhcCCCCCCCChhheeCCCCCCCCCcccc
Confidence 56789999999999999998899999999999999999999999999999999999999999999996432359999998
Q ss_pred CC
Q 046574 93 LD 94 (104)
Q Consensus 93 ~~ 94 (104)
++
T Consensus 384 ~~ 385 (391)
T PLN02411 384 LS 385 (391)
T ss_pred cc
Confidence 74
|
|
| >PRK10605 N-ethylmaleimide reductase; Provisional | Back alignment and domain information |
|---|
| >COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >KOG0134 consensus NADH:flavin oxidoreductase/12-oxophytodienoate reductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] | Back alignment and domain information |
|---|
| >cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain | Back alignment and domain information |
|---|
| >cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 | Back alignment and domain information |
|---|
| >cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
| >cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 | Back alignment and domain information |
|---|
| >PRK13523 NADPH dehydrogenase NamA; Provisional | Back alignment and domain information |
|---|
| >cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain | Back alignment and domain information |
|---|
| >cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
| >PRK07259 dihydroorotate dehydrogenase 1B; Reviewed | Back alignment and domain information |
|---|
| >TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein | Back alignment and domain information |
|---|
| >TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK10415 tRNA-dihydrouridine synthase B; Provisional | Back alignment and domain information |
|---|
| >PRK11815 tRNA-dihydrouridine synthase A; Provisional | Back alignment and domain information |
|---|
| >PRK05286 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >TIGR00742 yjbN tRNA dihydrouridine synthase A | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 | Back alignment and domain information |
|---|
| >cd02911 arch_FMN Archeal FMN-binding domain | Back alignment and domain information |
|---|
| >cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins | Back alignment and domain information |
|---|
| >PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA | Back alignment and domain information |
|---|
| >cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR00736 nifR3_rel_arch TIM-barrel protein, putative | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >cd02812 PcrB_like PcrB_like proteins | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein | Back alignment and domain information |
|---|
| >COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07695 transcriptional regulator TenI; Provisional | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway | Back alignment and domain information |
|---|
| >KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PLN02826 dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) | Back alignment and domain information |
|---|
| >PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >PRK02506 dihydroorotate dehydrogenase 1A; Reviewed | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) | Back alignment and domain information |
|---|
| >TIGR01163 rpe ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >PRK05581 ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 | Back alignment and domain information |
|---|
| >TIGR00693 thiE thiamine-phosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 | Back alignment and domain information |
|---|
| >PRK06512 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >PLN02334 ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02708 L_lactate_ox L-lactate oxidase | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) | Back alignment and domain information |
|---|
| >PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK04302 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >PLN02495 oxidoreductase, acting on the CH-CH group of donors | Back alignment and domain information |
|---|
| >TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase | Back alignment and domain information |
|---|
| >PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK02615 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >PRK03512 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK08883 ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: |
Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >TIGR02814 pfaD_fam PfaD family protein | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02591 tryptophan synthase | Back alignment and domain information |
|---|
| >CHL00200 trpA tryptophan synthase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >CHL00162 thiG thiamin biosynthesis protein G; Validated | Back alignment and domain information |
|---|
| >PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01182 eda Entner-Doudoroff aldolase | Back alignment and domain information |
|---|
| >PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK13125 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 | Back alignment and domain information |
|---|
| >PRK06806 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK08005 epimerase; Validated | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >PRK07226 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 | Back alignment and domain information |
|---|
| >PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences | Back alignment and domain information |
|---|
| >PRK13813 orotidine 5'-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >PRK00507 deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase | Back alignment and domain information |
|---|
| >PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] | Back alignment and domain information |
|---|
| >cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate | Back alignment and domain information |
|---|
| >PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 | Back alignment and domain information |
|---|
| >PRK08745 ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK08091 ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14567 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK13957 indole-3-glycerol-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07315 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 | Back alignment and domain information |
|---|
| >cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain | Back alignment and domain information |
|---|
| >PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) | Back alignment and domain information |
|---|
| >PRK14057 epimerase; Provisional | Back alignment and domain information |
|---|
| >PTZ00333 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] | Back alignment and domain information |
|---|
| >PRK14565 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 | Back alignment and domain information |
|---|
| >TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family | Back alignment and domain information |
|---|
| >PLN02460 indole-3-glycerol-phosphate synthase | Back alignment and domain information |
|---|
| >PRK09722 allulose-6-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR01182 eda Entner-Doudoroff aldolase | Back alignment and domain information |
|---|
| >PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1436 consensus Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >KOG0538 consensus Glycolate oxidase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK00042 tpiA triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02561 triosephosphate isomerase | Back alignment and domain information |
|---|
| >PRK06801 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >COG1058 CinA Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway | Back alignment and domain information |
|---|
| >COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK07188 nicotinate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01334 modD putative molybdenum utilization protein ModD | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related | Back alignment and domain information |
|---|
| >KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides | Back alignment and domain information |
|---|
| >cd00945 Aldolase_Class_I Class I aldolases | Back alignment and domain information |
|---|
| >PRK15492 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 | Back alignment and domain information |
|---|
| >PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 104 | ||||
| 1icp_A | 376 | Crystal Structure Of 12-Oxophytodienoate Reductase | 2e-41 | ||
| 1vji_A | 372 | Gene Product Of At1g76680 From Arabidopsis Thaliana | 2e-39 | ||
| 2hs6_A | 402 | Crystal Structure Of The E291k Mutant Of 12- Oxophy | 3e-28 | ||
| 3hgo_A | 402 | Crystal Structure Of The F74yH244Y OPR3 DOUBLE MUTA | 4e-28 | ||
| 2hs8_A | 402 | Crystal Structure Of The Y364f Mutant Of 12- Oxophy | 9e-28 | ||
| 1q45_A | 391 | 12-0xo-Phytodienoate Reductase Isoform 3 Length = 3 | 3e-25 | ||
| 3gka_A | 361 | Crystal Structure Of N-Ethylmaleimidine Reductase F | 3e-17 | ||
| 4ab4_A | 362 | Structure Of Xenobiotic Reductase B From Pseudomona | 1e-15 | ||
| 3gx9_A | 377 | Structure Of Morphinone Reductase N189a Mutant In C | 7e-15 | ||
| 2r14_A | 377 | Structure Of Morphinone Reductase In Complex With T | 7e-15 | ||
| 1gwj_A | 377 | Morphinone Reductase Length = 377 | 7e-15 | ||
| 4a3u_A | 358 | X-Structure Of The Old Yellow Enzyme Homologue From | 9e-13 | ||
| 2gou_A | 365 | Structure Of Wild Type, Oxidized Sye1, An Oye Homol | 3e-11 | ||
| 3aty_A | 379 | Crystal Structure Of Tcoye Length = 379 | 2e-10 | ||
| 3p67_A | 373 | T26s Mutant Of Pentaerythritol Tetranitrate Reducta | 4e-10 | ||
| 3p7y_A | 365 | Pentaerythritol Tetranitrate Reductase Co-Crystal S | 4e-10 | ||
| 2abb_A | 364 | Structure Of Petn Reductase Y186f In Complex With C | 4e-10 | ||
| 3p62_A | 373 | Wild-Type Pentaerythritol Tetranitrate Reductase Co | 4e-10 | ||
| 1h50_A | 364 | Stucture Of Pentaerythritol Tetranitrate Reductase | 4e-10 | ||
| 3p74_A | 373 | H181n Mutant Of Pentaerythritol Tetranitrate Reduct | 4e-10 | ||
| 3p82_A | 365 | H184n Mutant Of Pentaerythritol Tetranitrate Reduct | 4e-10 | ||
| 1vyp_X | 364 | Stucture Of Pentaerythritol Tetranitrate Reductase | 5e-10 | ||
| 1vys_X | 364 | Stucture Of Pentaerythritol Tetranitrate Reductase | 5e-10 | ||
| 3p8i_A | 365 | Y351f Mutant Of Pentaerythritol Tetranitrate Reduct | 1e-09 | ||
| 3p84_A | 365 | Y351a Mutant Of Pentaerythritol Tetranitrate Reduct | 3e-09 | ||
| 3p8j_A | 365 | Y351s Mutant Of Pentaerythritol Tetranitrate Reduct | 4e-09 | ||
| 1bwl_A | 399 | Old Yellow Enzyme (Oye1) Double Mutant H191n:n194h | 7e-09 | ||
| 1oya_A | 400 | Old Yellow Enzyme At 2 Angstroms Resolution: Overal | 7e-09 | ||
| 1bwk_A | 399 | Old Yellow Enzyme (Oye1) Mutant H191n Length = 399 | 8e-09 | ||
| 4ge8_A | 400 | Oye1-W116i Complexed With (S)-Carvone Length = 400 | 8e-09 | ||
| 3txz_A | 400 | Oye1-W116q Complexed With R-Carvone Length = 400 | 8e-09 | ||
| 3rnd_A | 399 | W116i-Oye1 Complexed With 2-(Hydroxymethyl)-Cyclope | 8e-09 | ||
| 4gbu_A | 400 | Oye1-W116a In Complex With Aromatic Product Of S-Ca | 2e-08 | ||
| 4gwe_A | 400 | W116l-Oye1 Complexed With (R)-Carvone Length = 400 | 2e-08 | ||
| 1k02_A | 399 | Crystal Structure Of Old Yellow Enzyme Mutant Gln11 | 2e-08 | ||
| 3tjl_A | 407 | Crystal Structure Of A Novel Oye From The Xylose-Fe | 8e-04 | ||
| 4df2_A | 407 | P. Stipitis Oye2.6 Complexed With P-Chlorophenol Le | 8e-04 |
| >pdb|1ICP|A Chain A, Crystal Structure Of 12-Oxophytodienoate Reductase 1 From Tomato Complexed With Peg400 Length = 376 | Back alignment and structure |
|
| >pdb|1VJI|A Chain A, Gene Product Of At1g76680 From Arabidopsis Thaliana Length = 372 | Back alignment and structure |
| >pdb|2HS6|A Chain A, Crystal Structure Of The E291k Mutant Of 12- Oxophytodienoate Reductase 3 (Opr3) From Tomato Length = 402 | Back alignment and structure |
| >pdb|3HGO|A Chain A, Crystal Structure Of The F74yH244Y OPR3 DOUBLE MUTANT FROM Tomato Length = 402 | Back alignment and structure |
| >pdb|2HS8|A Chain A, Crystal Structure Of The Y364f Mutant Of 12- Oxophytodienoate Reductase 3 From Tomato Length = 402 | Back alignment and structure |
| >pdb|1Q45|A Chain A, 12-0xo-Phytodienoate Reductase Isoform 3 Length = 391 | Back alignment and structure |
| >pdb|3GKA|A Chain A, Crystal Structure Of N-Ethylmaleimidine Reductase From Burkholderia Pseudomallei Length = 361 | Back alignment and structure |
| >pdb|4AB4|A Chain A, Structure Of Xenobiotic Reductase B From Pseudomonas Putida In Complex With Tnt Length = 362 | Back alignment and structure |
| >pdb|3GX9|A Chain A, Structure Of Morphinone Reductase N189a Mutant In Complex With Tetrahydronad Length = 377 | Back alignment and structure |
| >pdb|2R14|A Chain A, Structure Of Morphinone Reductase In Complex With Tetrahydronad Length = 377 | Back alignment and structure |
| >pdb|1GWJ|A Chain A, Morphinone Reductase Length = 377 | Back alignment and structure |
| >pdb|4A3U|A Chain A, X-Structure Of The Old Yellow Enzyme Homologue From Zymomonas Mobilis (Ncr) Length = 358 | Back alignment and structure |
| >pdb|2GOU|A Chain A, Structure Of Wild Type, Oxidized Sye1, An Oye Homologue From S. Oneidensis Length = 365 | Back alignment and structure |
| >pdb|3ATY|A Chain A, Crystal Structure Of Tcoye Length = 379 | Back alignment and structure |
| >pdb|3P67|A Chain A, T26s Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 373 | Back alignment and structure |
| >pdb|3P7Y|A Chain A, Pentaerythritol Tetranitrate Reductase Co-Crystal Structure With Bound (E)-1-(2'-Hydroxyphenyl)-2-Nitroethene Length = 365 | Back alignment and structure |
| >pdb|2ABB|A Chain A, Structure Of Petn Reductase Y186f In Complex With Cyanide Length = 364 | Back alignment and structure |
| >pdb|3P62|A Chain A, Wild-Type Pentaerythritol Tetranitrate Reductase Containing A C- Terminal 8-Histidine Tag Length = 373 | Back alignment and structure |
| >pdb|1H50|A Chain A, Stucture Of Pentaerythritol Tetranitrate Reductase And Complexes Length = 364 | Back alignment and structure |
| >pdb|3P74|A Chain A, H181n Mutant Of Pentaerythritol Tetranitrate Reductase Containing A C- Terminal His8-Tag Length = 373 | Back alignment and structure |
| >pdb|3P82|A Chain A, H184n Mutant Of Pentaerythritol Tetranitrate Reductase Containing Bound Acetate Ion Length = 365 | Back alignment and structure |
| >pdb|1VYP|X Chain X, Stucture Of Pentaerythritol Tetranitrate Reductase W102f Mutant And Complexed With Picric Acid Length = 364 | Back alignment and structure |
| >pdb|1VYS|X Chain X, Stucture Of Pentaerythritol Tetranitrate Reductase W102y Mutant And Complexed With Picric Acid Length = 364 | Back alignment and structure |
| >pdb|3P8I|A Chain A, Y351f Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 | Back alignment and structure |
| >pdb|3P84|A Chain A, Y351a Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 | Back alignment and structure |
| >pdb|3P8J|A Chain A, Y351s Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 | Back alignment and structure |
| >pdb|1BWL|A Chain A, Old Yellow Enzyme (Oye1) Double Mutant H191n:n194h Length = 399 | Back alignment and structure |
| >pdb|1OYA|A Chain A, Old Yellow Enzyme At 2 Angstroms Resolution: Overall Structure, Ligand Binding And Comparison With Related Flavoproteins Length = 400 | Back alignment and structure |
| >pdb|1BWK|A Chain A, Old Yellow Enzyme (Oye1) Mutant H191n Length = 399 | Back alignment and structure |
| >pdb|4GE8|A Chain A, Oye1-W116i Complexed With (S)-Carvone Length = 400 | Back alignment and structure |
| >pdb|3TXZ|A Chain A, Oye1-W116q Complexed With R-Carvone Length = 400 | Back alignment and structure |
| >pdb|3RND|A Chain A, W116i-Oye1 Complexed With 2-(Hydroxymethyl)-Cyclopent-2-Enone Length = 399 | Back alignment and structure |
| >pdb|4GBU|A Chain A, Oye1-W116a In Complex With Aromatic Product Of S-Carvone Dismutation Length = 400 | Back alignment and structure |
| >pdb|4GWE|A Chain A, W116l-Oye1 Complexed With (R)-Carvone Length = 400 | Back alignment and structure |
| >pdb|1K02|A Chain A, Crystal Structure Of Old Yellow Enzyme Mutant Gln114asn Length = 399 | Back alignment and structure |
| >pdb|3TJL|A Chain A, Crystal Structure Of A Novel Oye From The Xylose-Fermenting Fungus P. Stipitis Length = 407 | Back alignment and structure |
| >pdb|4DF2|A Chain A, P. Stipitis Oye2.6 Complexed With P-Chlorophenol Length = 407 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 104 | |||
| 1icp_A | 376 | OPR1, 12-oxophytodienoate reductase 1; beta-alpha- | 3e-51 | |
| 2hsa_B | 402 | 12-oxophytodienoate reductase 3; alpha beta 8 barr | 2e-47 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 5e-46 | |
| 2r14_A | 377 | Morphinone reductase; H-tunnelling, flavoprotein, | 6e-46 | |
| 3aty_A | 379 | Tcoye, prostaglandin F2A synthase; alpha/beta barr | 1e-45 | |
| 3gka_A | 361 | N-ethylmaleimide reductase; decode biostructures, | 6e-45 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 6e-44 | |
| 3rnd_A | 399 | NADPH dehydrogenase 1; TIM barrel, oxidoreductase; | 3e-43 | |
| 3tjl_A | 407 | NADPH dehydrogenase; OLD yellow enzyme, flavin mon | 9e-41 | |
| 3l5a_A | 419 | NADH/flavin oxidoreductase/NADH oxidase; OLD yello | 1e-08 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 2e-05 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 2e-05 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 2e-05 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 2e-05 | |
| 3kru_A | 343 | NADH:flavin oxidoreductase/NADH oxidase; homotetra | 4e-05 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 4e-05 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 4e-05 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 5e-05 |
| >1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Length = 376 | Back alignment and structure |
|---|
Score = 164 bits (417), Expect = 3e-51
Identities = 72/97 (74%), Positives = 84/97 (86%)
Query: 1 MKTVGEKSECPHSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDL 60
MKT EK EC SL+ MRKA+KGTF+VAGGYDREDGN+A+ E RADLV YGR F++NPDL
Sbjct: 280 MKTAWEKIECTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDL 339
Query: 61 PRRFEFNAPLNKYNRETFYVSDPVVGYTDYPFLDTSS 97
P+RFE NAPLNKYNR+TFY SDP+VGYTDYPFL+T +
Sbjct: 340 PKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFLETMT 376
|
| >2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Length = 402 | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Length = 364 | Back alignment and structure |
|---|
| >2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Length = 377 | Back alignment and structure |
|---|
| >3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Length = 379 | Back alignment and structure |
|---|
| >3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} Length = 361 | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Length = 365 | Back alignment and structure |
|---|
| >3rnd_A NADPH dehydrogenase 1; TIM barrel, oxidoreductase; HET: FMN 3RN; 1.40A {Saccharomyces pastorianus} PDB: 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Length = 399 | Back alignment and structure |
|---|
| >3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Length = 407 | Back alignment and structure |
|---|
| >3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Length = 419 | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Length = 338 | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} PDB: 3hf3_A* Length = 349 | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Length = 363 | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Length = 340 | Back alignment and structure |
|---|
| >3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} PDB: 3krz_A* Length = 343 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| 4a3u_A | 358 | NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET | 99.89 | |
| 4gbu_A | 400 | NADPH dehydrogenase 1; alpha/beta barrel, enenone | 99.88 | |
| 4ab4_A | 362 | Xenobiotic reductase B; oxidoreductase, OLD yellow | 99.87 | |
| 3gka_A | 361 | N-ethylmaleimide reductase; decode biostructures, | 99.86 | |
| 2hsa_B | 402 | 12-oxophytodienoate reductase 3; alpha beta 8 barr | 99.85 | |
| 2r14_A | 377 | Morphinone reductase; H-tunnelling, flavoprotein, | 99.84 | |
| 3aty_A | 379 | Tcoye, prostaglandin F2A synthase; alpha/beta barr | 99.84 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 99.83 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 99.83 | |
| 1icp_A | 376 | OPR1, 12-oxophytodienoate reductase 1; beta-alpha- | 99.83 | |
| 3tjl_A | 407 | NADPH dehydrogenase; OLD yellow enzyme, flavin mon | 99.81 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 99.44 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 99.39 | |
| 3kru_A | 343 | NADH:flavin oxidoreductase/NADH oxidase; homotetra | 99.38 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 99.35 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 99.34 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 99.33 | |
| 3l5a_A | 419 | NADH/flavin oxidoreductase/NADH oxidase; OLD yello | 99.3 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 99.29 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 99.22 | |
| 1f76_A | 336 | Dihydroorotate dehydrogenase; monomer, alpha-beta- | 98.96 | |
| 3b0p_A | 350 | TRNA-dihydrouridine synthase; TIM barrel, oxidored | 98.85 | |
| 2e6f_A | 314 | Dihydroorotate dehydrogenase; chagas disease, pyri | 98.8 | |
| 1ep3_A | 311 | Dihydroorotate dehydrogenase B (PYRD subunit); het | 98.79 | |
| 1vhn_A | 318 | Putative flavin oxidoreducatase; structural genomi | 98.78 | |
| 1jub_A | 311 | Dihydroorotate dehydrogenase A; homodimer, alpha-b | 98.75 | |
| 1tv5_A | 443 | Dhodehase, dihydroorotate dehydrogenase homolog, m | 98.61 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 98.6 | |
| 3oix_A | 345 | Putative dihydroorotate dehydrogenase; dihydrooro | 98.44 | |
| 4ef8_A | 354 | Dihydroorotate dehydrogenase; phenyl isothiocyanat | 98.4 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 98.38 | |
| 3zwt_A | 367 | Dihydroorotate dehydrogenase (quinone), mitochond; | 98.38 | |
| 3i65_A | 415 | Dihydroorotate dehydrogenase homolog, mitochondria | 98.36 | |
| 2z6i_A | 332 | Trans-2-enoyl-ACP reductase II; fatty acid synthes | 98.26 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 98.23 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 98.13 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 98.1 | |
| 3vk5_A | 286 | MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S | 98.09 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 98.04 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 98.03 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 98.02 | |
| 3bw2_A | 369 | 2-nitropropane dioxygenase; TIM barrel, oxidoreduc | 98.0 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 97.97 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 97.95 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 97.94 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 97.92 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 97.9 | |
| 3tjx_A | 354 | Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh | 97.9 | |
| 3vzx_A | 228 | Heptaprenylglyceryl phosphate synthase; biosynthes | 97.9 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.85 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 97.85 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 97.85 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 97.73 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 97.73 | |
| 1viz_A | 240 | PCRB protein homolog; structural genomics, unknown | 97.73 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 97.73 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 97.72 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 97.68 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 97.66 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 97.63 | |
| 3w01_A | 235 | Heptaprenylglyceryl phosphate synthase; biosynthes | 97.61 | |
| 1xi3_A | 215 | Thiamine phosphate pyrophosphorylase; structural g | 97.58 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 97.56 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 97.56 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 97.55 | |
| 3o07_A | 291 | Pyridoxine biosynthesis protein SNZ1; (beta/alpha) | 97.53 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 97.51 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 97.47 | |
| 1xm3_A | 264 | Thiazole biosynthesis protein THIG; structural gen | 97.42 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 97.42 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 97.42 | |
| 2tps_A | 227 | Protein (thiamin phosphate synthase); thiamin bios | 97.4 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 97.39 | |
| 3bo9_A | 326 | Putative nitroalkan dioxygenase; TM0800, structura | 97.39 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 97.38 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 97.34 | |
| 1wa3_A | 205 | 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, | 97.34 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 97.34 | |
| 1rpx_A | 230 | Protein (ribulose-phosphate 3-epimerase); chloropl | 97.32 | |
| 1h1y_A | 228 | D-ribulose-5-phosphate 3-epimerase; oxidative pent | 97.31 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.31 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 97.3 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 97.26 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 97.25 | |
| 2f6u_A | 234 | GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy | 97.24 | |
| 2nv1_A | 305 | Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b | 97.24 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 97.23 | |
| 2yzr_A | 330 | Pyridoxal biosynthesis lyase PDXS; redox protein, | 97.23 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 97.21 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 97.21 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 97.19 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 97.15 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 97.1 | |
| 1mzh_A | 225 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 97.08 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 97.04 | |
| 3kts_A | 192 | Glycerol uptake operon antiterminator regulatory; | 97.04 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.03 | |
| 3o63_A | 243 | Probable thiamine-phosphate pyrophosphorylase; thi | 97.03 | |
| 2v82_A | 212 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l | 97.02 | |
| 2zbt_A | 297 | Pyridoxal biosynthesis lyase PDXS; pyridoxine bios | 96.98 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 96.92 | |
| 4adt_A | 297 | Pyridoxine biosynthetic enzyme PDX1 homologue, PU; | 96.92 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 96.91 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 96.91 | |
| 2qjg_A | 273 | Putative aldolase MJ0400; beta-alpha barrel, lyase | 96.87 | |
| 1tqj_A | 230 | Ribulose-phosphate 3-epimerase; beta-alpha barrel | 96.85 | |
| 3ceu_A | 210 | Thiamine phosphate pyrophosphorylase; TIM barrel-l | 96.82 | |
| 2yw3_A | 207 | 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox | 96.78 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 96.78 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 96.74 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 96.7 | |
| 1q6o_A | 216 | Humps, 3-keto-L-gulonate 6-phosphate decarboxylase | 96.68 | |
| 3ovp_A | 228 | Ribulose-phosphate 3-epimerase; iron binding, isom | 96.63 | |
| 3jr2_A | 218 | Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon | 96.59 | |
| 1tqx_A | 227 | D-ribulose-5-phosphate 3-epimerase, putative; stru | 96.57 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 96.57 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.55 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 96.5 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 96.49 | |
| 1geq_A | 248 | Tryptophan synthase alpha-subunit; hyperthermophIl | 96.47 | |
| 2czd_A | 208 | Orotidine 5'-phosphate decarboxylase; pyrimidine b | 96.47 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 96.47 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 96.42 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 96.42 | |
| 1rd5_A | 262 | Tryptophan synthase alpha chain, chloroplast; hydr | 96.36 | |
| 3nav_A | 271 | Tryptophan synthase alpha chain; alpha subunit, st | 96.31 | |
| 2h6r_A | 219 | Triosephosphate isomerase; beta-alpha barrel; 2.30 | 96.3 | |
| 1qop_A | 268 | Tryptophan synthase alpha chain; lyase, carbon-oxy | 96.24 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 96.22 | |
| 2htm_A | 268 | Thiazole biosynthesis protein THIG; thiamin biosyn | 96.22 | |
| 2ekc_A | 262 | AQ_1548, tryptophan synthase alpha chain; structur | 96.1 | |
| 3vnd_A | 267 | TSA, tryptophan synthase alpha chain; psychrophili | 96.0 | |
| 1eix_A | 245 | Orotidine 5'-monophosphate decarboxylase; alpha-be | 95.96 | |
| 1wbh_A | 214 | KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} | 95.94 | |
| 1ujp_A | 271 | Tryptophan synthase alpha chain; riken structural | 95.94 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 95.9 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 95.89 | |
| 3inp_A | 246 | D-ribulose-phosphate 3-epimerase; IDP02542, isomer | 95.88 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 95.75 | |
| 2yyu_A | 246 | Orotidine 5'-phosphate decarboxylase; TIM barrel, | 95.69 | |
| 1dbt_A | 239 | Orotidine 5'-phosphate decarboxylase; UMP, TIM bar | 95.58 | |
| 3cu2_A | 237 | Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib | 95.55 | |
| 3ctl_A | 231 | D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p | 95.52 | |
| 4a29_A | 258 | Engineered retro-aldol enzyme RA95.0; de novo prot | 95.49 | |
| 3exr_A | 221 | RMPD (hexulose-6-phosphate synthase); beta barrel, | 95.47 | |
| 1w8s_A | 263 | FBP aldolase, fructose-bisphosphate aldolase class | 95.39 | |
| 3ve9_A | 215 | Orotidine-5'-phosphate decarboxylase; TIM barrel f | 95.39 | |
| 3tha_A | 252 | Tryptophan synthase alpha chain; structural genomi | 95.28 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 95.04 | |
| 3nl6_A | 540 | Thiamine biosynthetic bifunctional enzyme; thiamin | 94.92 | |
| 1mxs_A | 225 | KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a | 94.88 | |
| 1vkf_A | 188 | Glycerol uptake operon antiterminator-related Pro; | 94.75 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 94.5 | |
| 2pgw_A | 384 | Muconate cycloisomerase; enolase superfamily, octa | 94.42 | |
| 4dbe_A | 222 | Orotidine 5'-phosphate decarboxylase; TIM barrel, | 94.28 | |
| 1x1o_A | 286 | Nicotinate-nucleotide pyrophosphorylase; transfera | 94.2 | |
| 1vqt_A | 213 | Orotidine 5'-phosphate decarboxylase; TM0332, stru | 94.07 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 94.04 | |
| 2b7n_A | 273 | Probable nicotinate-nucleotide pyrophosphorylase; | 94.04 | |
| 1ea0_A | 1479 | Glutamate synthase [NADPH] large chain; oxidoreduc | 93.82 | |
| 1i4n_A | 251 | Indole-3-glycerol phosphate synthase; thermostable | 93.66 | |
| 1ofd_A | 1520 | Ferredoxin-dependent glutamate synthase 2; oxidore | 93.58 | |
| 2rdx_A | 379 | Mandelate racemase/muconate lactonizing enzyme, P; | 93.49 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 93.29 | |
| 1mdl_A | 359 | Mandelate racemase; isomerase, mandelate pathway, | 93.21 | |
| 3ru6_A | 303 | Orotidine 5'-phosphate decarboxylase; structural g | 93.19 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 93.02 | |
| 2og9_A | 393 | Mandelate racemase/muconate lactonizing enzyme; NY | 93.0 | |
| 3glc_A | 295 | Aldolase LSRF; TIM barrel, lyase, schiff base; HET | 92.9 | |
| 2ovl_A | 371 | Putative racemase; structural genomics, PSI-2, pro | 92.57 | |
| 2jbm_A | 299 | Nicotinate-nucleotide pyrophosphorylase; NAD, enzy | 92.41 | |
| 1pii_A | 452 | N-(5'phosphoribosyl)anthranilate isomerase; bifunc | 92.33 | |
| 2nql_A | 388 | AGR_PAT_674P, isomerase/lactonizing enzyme; enolas | 92.24 | |
| 2qgy_A | 391 | Enolase from the environmental genome shotgun sequ | 92.23 | |
| 1to3_A | 304 | Putative aldolase YIHT; beta-alpha barrel, structu | 92.22 | |
| 3m47_A | 228 | Orotidine 5'-phosphate decarboxylase; orotidine 5' | 92.01 | |
| 1qap_A | 296 | Quinolinic acid phosphoribosyltransferase; glycosy | 91.99 | |
| 2ps2_A | 371 | Putative mandelate racemase/muconate lactonizing e | 91.99 | |
| 3tfx_A | 259 | Orotidine 5'-phosphate decarboxylase; PSI-biology, | 91.91 | |
| 1hg3_A | 225 | Triosephosphate isomerase; thermostability, tetram | 91.87 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 91.82 | |
| 1rvk_A | 382 | Isomerase/lactonizing enzyme; enolase superfamily, | 91.71 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 91.2 | |
| 1w0m_A | 226 | TIM, triosephosphate isomerase; glycolysis, glucon | 91.18 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 91.03 | |
| 2p8b_A | 369 | Mandelate racemase/muconate lactonizing enzyme fam | 90.96 | |
| 2qdd_A | 378 | Mandelate racemase/muconate lactonizing enzyme; en | 90.87 | |
| 1nu5_A | 370 | Chloromuconate cycloisomerase; enzyme, dehalogenat | 90.67 | |
| 2gl5_A | 410 | Putative dehydratase protein; structural genomics, | 90.67 | |
| 2pp0_A | 398 | L-talarate/galactarate dehydratase; enolase superf | 90.63 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 90.5 | |
| 3paj_A | 320 | Nicotinate-nucleotide pyrophosphorylase, carboxyl; | 90.47 | |
| 2o56_A | 407 | Putative mandelate racemase; dehydratase, structur | 90.24 | |
| 2hzg_A | 401 | Mandelate racemase/muconate lactonizing enzyme/EN | 90.01 | |
| 2qde_A | 397 | Mandelate racemase/muconate lactonizing enzyme FA | 89.95 | |
| 2gdq_A | 382 | YITF; mandelate racemase/muconate lactonizing enzy | 89.91 | |
| 2poz_A | 392 | Putative dehydratase; octamer, structural genomics | 89.89 | |
| 3c2e_A | 294 | Nicotinate-nucleotide pyrophosphorylase; qprtase, | 89.88 | |
| 2ox4_A | 403 | Putative mandelate racemase; enolase, dehydratase, | 89.73 | |
| 3mqt_A | 394 | Mandelate racemase/muconate lactonizing protein; P | 89.6 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 89.52 | |
| 2zad_A | 345 | Muconate cycloisomerase; muconate lactonizing enzy | 89.48 | |
| 3mkc_A | 394 | Racemase; metabolic process, PSI2, NYSGXRC, struct | 89.36 | |
| 3rcy_A | 433 | Mandelate racemase/muconate lactonizing enzyme-LI | 89.33 | |
| 1sjd_A | 368 | N-acylamino acid racemase; lyase, isomerase; HET: | 89.3 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 89.27 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 89.1 | |
| 3go2_A | 409 | Putative L-alanine-DL-glutamate epimerase; structu | 89.09 | |
| 3tr2_A | 239 | Orotidine 5'-phosphate decarboxylase; purines, pyr | 88.95 | |
| 3dip_A | 410 | Enolase; structural genomics, isomerase, PSI-2, pr | 88.95 | |
| 3rr1_A | 405 | GALD, putative D-galactonate dehydratase; enolase, | 88.9 | |
| 2uv8_G | 2051 | Fatty acid synthase subunit beta (FAS1); fatty aci | 88.87 | |
| 3sbf_A | 401 | Mandelate racemase / muconate lactonizing enzyme; | 88.81 | |
| 3jva_A | 354 | Dipeptide epimerase; enolase superfamily, isomeras | 88.62 | |
| 2qq6_A | 410 | Mandelate racemase/muconate lactonizing enzyme- li | 88.59 | |
| 3stp_A | 412 | Galactonate dehydratase, putative; PSI biology, st | 88.48 | |
| 1o4u_A | 285 | Type II quinolic acid phosphoribosyltransferase; s | 88.36 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 88.33 | |
| 4e5t_A | 404 | Mandelate racemase / muconate lactonizing enzyme, | 88.31 | |
| 3eez_A | 378 | Putative mandelate racemase/muconate lactonizing e | 88.07 | |
| 3dg3_A | 367 | Muconate cycloisomerase; muconate lactonizing enzy | 88.07 | |
| 3ozy_A | 389 | Putative mandelate racemase; beta-alpha barrel, en | 88.04 | |
| 3i4k_A | 383 | Muconate lactonizing enzyme; structural genomics, | 87.99 | |
| 3tqv_A | 287 | Nicotinate-nucleotide pyrophosphorylase; glycosylt | 87.92 | |
| 2oz8_A | 389 | MLL7089 protein; structural genomics, unknown func | 87.83 | |
| 1tkk_A | 366 | Similar to chloromuconate cycloisomerase; epimeras | 87.78 | |
| 3vcn_A | 425 | Mannonate dehydratase; enolase, magnesium binding | 87.7 | |
| 3v3w_A | 424 | Starvation sensing protein RSPA; enolase, enzyme f | 87.35 | |
| 3sjn_A | 374 | Mandelate racemase/muconate lactonizing protein; e | 87.18 | |
| 4dxk_A | 400 | Mandelate racemase / muconate lactonizing enzyme p | 87.14 | |
| 3r4e_A | 418 | Mandelate racemase/muconate lactonizing enzyme; en | 86.99 | |
| 3bjs_A | 428 | Mandelate racemase/muconate lactonizing enzyme; en | 86.98 | |
| 4e4u_A | 412 | Mandalate racemase/muconate lactonizing enzyme; ma | 86.9 | |
| 3ldv_A | 255 | Orotidine 5'-phosphate decarboxylase; structural g | 86.89 | |
| 1qpo_A | 284 | Quinolinate acid phosphoribosyl transferase; type | 86.84 | |
| 3ngj_A | 239 | Deoxyribose-phosphate aldolase; lyase, structural | 86.83 | |
| 2v5b_A | 244 | Triosephosphate isomerase; TIM, unfolding, monotct | 86.77 | |
| 3tj4_A | 372 | Mandelate racemase; enolase, dehydratase, enzyme f | 86.58 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 86.49 | |
| 3krs_A | 271 | Triosephosphate isomerase; ssgcid, SBRI, emerald b | 86.33 | |
| 3oa3_A | 288 | Aldolase; structural genomics, seattle structural | 85.91 | |
| 3tji_A | 422 | Mandelate racemase/muconate lactonizing enzyme, N | 85.9 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 85.85 | |
| 3ddm_A | 392 | Putative mandelate racemase/muconate lactonizing e | 85.85 | |
| 1tzz_A | 392 | Hypothetical protein L1841; structural genomics, m | 85.68 | |
| 2hxt_A | 441 | L-fuconate dehydratase; enolase superfamily, D-ery | 85.56 | |
| 3qst_A | 255 | Triosephosphate isomerase, putative; TIM barrel; 1 | 85.53 | |
| 3q45_A | 368 | Mandelate racemase/muconate lactonizing enzyme FA | 85.52 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 85.51 | |
| 1r0m_A | 375 | N-acylamino acid racemase; isomerase; 1.30A {Deino | 85.29 | |
| 3my9_A | 377 | Muconate cycloisomerase; structural genomics, PSI- | 85.27 | |
| 1o5x_A | 248 | TIM, triosephosphate isomerase; 2- phosphoglycerat | 85.25 | |
| 1chr_A | 370 | Chloromuconate cycloisomerase; 3.00A {Ralstonia eu | 85.14 | |
| 4dwd_A | 393 | Mandelate racemase/muconate lactonizing enzyme, C | 84.94 | |
| 3gnn_A | 298 | Nicotinate-nucleotide pyrophosphorylase; decode bi | 84.91 | |
| 2zc8_A | 369 | N-acylamino acid racemase; octamer, TIM beta/alpha | 84.89 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 84.69 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 84.5 | |
| 3l0g_A | 300 | Nicotinate-nucleotide pyrophosphorylase; ssgcid, N | 84.42 | |
| 2j27_A | 250 | Triosephosphate isomerase glycosomal; TIM, 2PG, LO | 84.35 | |
| 3t6c_A | 440 | RSPA, putative MAND family dehydratase; enolase, m | 84.34 | |
| 1ub3_A | 220 | Aldolase protein; schiff base, deoxyribose phospha | 84.27 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 83.95 | |
| 1n7k_A | 234 | Deoxyribose-phosphate aldolase; A.pernix, tetramer | 83.77 | |
| 3ugv_A | 390 | Enolase; enzyme function initiative, EFI, lyase; 2 | 83.37 | |
| 3r12_A | 260 | Deoxyribose-phosphate aldolase; TIM beta/alpha-bar | 83.24 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 83.18 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 82.81 | |
| 2i1o_A | 398 | Nicotinate phosphoribosyltransferase; ZIN ION, zin | 82.73 | |
| 2vxn_A | 251 | Triosephosphate isomerase; fatty acid biosynthesis | 82.57 | |
| 3p3b_A | 392 | Mandelate racemase/muconate lactonizing protein; e | 82.53 | |
| 2jgq_A | 233 | Triosephosphate isomerase; glycolysis, pentose shu | 82.36 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 82.3 | |
| 3ndo_A | 231 | Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid | 81.99 | |
| 4e4f_A | 426 | Mannonate dehydratase; magnesium binding, enzyme f | 81.85 | |
| 3mwc_A | 400 | Mandelate racemase/muconate lactonizing protein; e | 81.31 | |
| 3toy_A | 383 | Mandelate racemase/muconate lactonizing enzyme FA | 81.24 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 81.1 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 80.3 |
| >4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} | Back alignment and structure |
|---|
Probab=99.89 E-value=5.4e-23 Score=159.38 Aligned_cols=84 Identities=43% Similarity=0.702 Sum_probs=76.2
Q ss_pred chHHHHHHHHcCCeEEEeCCCCHHHHHHHHHcCCCcEEecchHHhhCCcHHHHHhhCCCCCCCCccccccCCCCCCcccC
Q 046574 11 PHSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDLPRRFEFNAPLNKYNRETFYVSDPVVGYTDY 90 (104)
Q Consensus 11 ~~~~~~ir~~~~~pvi~~Ggi~~~~ae~~l~~g~~DlVa~gR~~lanPdl~~ri~~g~~l~~~d~~~~~~~~~~~gy~d~ 90 (104)
...+..+|+.+..|||++|+.+++.|+++|++|.+|+|++||++|+|||||+|+++|+|++++|+++||+.+ .+||+||
T Consensus 275 ~~~a~~ik~~~~~~v~~~g~~~~~~ae~~l~~G~aD~V~~gR~~ladPdlp~k~~~g~pl~~~~~~t~y~~~-~~GY~dy 353 (358)
T 4a3u_A 275 PKLSPEIRKVFKPPLVLNQDYTFETAQAALDSGVADAISFGRPFIGNPDLPRRFFEKAPLTKDVIETWYTQT-PKGYTDY 353 (358)
T ss_dssp CCCHHHHHHHCCSCEEEESSCCHHHHHHHHHHTSCSEEEESHHHHHCTTHHHHHHHTCCCCCCCGGGSSCSS-STTTTCS
T ss_pred HHHHHHHHHhcCCcEEEeCCCCHHHHHHHHHcCCceEeHhhHHHHhChhHHHHHHhCCCCCCCchhcCCCCC-CCCcCCC
Confidence 356788999998888887777999999999999999999999999999999999999999999999999876 6999999
Q ss_pred CCCCC
Q 046574 91 PFLDT 95 (104)
Q Consensus 91 p~~~~ 95 (104)
|++++
T Consensus 354 p~~~e 358 (358)
T 4a3u_A 354 PLLGD 358 (358)
T ss_dssp CCC--
T ss_pred CCCCC
Confidence 99874
|
| >4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* | Back alignment and structure |
|---|
| >4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 | Back alignment and structure |
|---|
| >2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* | Back alignment and structure |
|---|
| >2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* | Back alignment and structure |
|---|
| >3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... | Back alignment and structure |
|---|
| >1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* | Back alignment and structure |
|---|
| >3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* | Back alignment and structure |
|---|
| >2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* | Back alignment and structure |
|---|
| >1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* | Back alignment and structure |
|---|
| >1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* | Back alignment and structure |
|---|
| >1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A | Back alignment and structure |
|---|
| >3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* | Back alignment and structure |
|---|
| >3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... | Back alignment and structure |
|---|
| >3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* | Back alignment and structure |
|---|
| >2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* | Back alignment and structure |
|---|
| >3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* | Back alignment and structure |
|---|
| >3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A | Back alignment and structure |
|---|
| >1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} | Back alignment and structure |
|---|
| >2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* | Back alignment and structure |
|---|
| >2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* | Back alignment and structure |
|---|
| >2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A | Back alignment and structure |
|---|
| >1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* | Back alignment and structure |
|---|
| >3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A | Back alignment and structure |
|---|
| >3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* | Back alignment and structure |
|---|
| >1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A | Back alignment and structure |
|---|
| >2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A | Back alignment and structure |
|---|
| >3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A | Back alignment and structure |
|---|
| >1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* | Back alignment and structure |
|---|
| >1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* | Back alignment and structure |
|---|
| >1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 | Back alignment and structure |
|---|
| >3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} | Back alignment and structure |
|---|
| >3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* | Back alignment and structure |
|---|
| >4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... | Back alignment and structure |
|---|
| >3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A | Back alignment and structure |
|---|
| >1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A | Back alignment and structure |
|---|
| >3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A | Back alignment and structure |
|---|
| >3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* | Back alignment and structure |
|---|
| >1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
| >2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* | Back alignment and structure |
|---|
| >1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* | Back alignment and structure |
|---|
| >1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A | Back alignment and structure |
|---|
| >1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* | Back alignment and structure |
|---|
| >2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A | Back alignment and structure |
|---|
| >3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* | Back alignment and structure |
|---|
| >3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O | Back alignment and structure |
|---|
| >2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A | Back alignment and structure |
|---|
| >2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A | Back alignment and structure |
|---|
| >1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A | Back alignment and structure |
|---|
| >2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A | Back alignment and structure |
|---|
| >2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} | Back alignment and structure |
|---|
| >1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... | Back alignment and structure |
|---|
| >1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* | Back alignment and structure |
|---|
| >2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B | Back alignment and structure |
|---|
| >1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* | Back alignment and structure |
|---|
| >2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} | Back alignment and structure |
|---|
| >2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A | Back alignment and structure |
|---|
| >2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* | Back alignment and structure |
|---|
| >2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} | Back alignment and structure |
|---|
| >3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A | Back alignment and structure |
|---|
| >3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A | Back alignment and structure |
|---|
| >3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A | Back alignment and structure |
|---|
| >1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* | Back alignment and structure |
|---|
| >3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} | Back alignment and structure |
|---|
| >3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A | Back alignment and structure |
|---|
| >2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* | Back alignment and structure |
|---|
| >3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A | Back alignment and structure |
|---|
| >3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* | Back alignment and structure |
|---|
| >2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} | Back alignment and structure |
|---|
| >3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A | Back alignment and structure |
|---|
| >1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} | Back alignment and structure |
|---|
| >3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* | Back alignment and structure |
|---|
| >3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* | Back alignment and structure |
|---|
| >3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A | Back alignment and structure |
|---|
| >3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A | Back alignment and structure |
|---|
| >3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A | Back alignment and structure |
|---|
| >3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} | Back alignment and structure |
|---|
| >4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A | Back alignment and structure |
|---|
| >3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* | Back alignment and structure |
|---|
| >3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} | Back alignment and structure |
|---|
| >3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* | Back alignment and structure |
|---|
| >1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* | Back alignment and structure |
|---|
| >3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} | Back alignment and structure |
|---|
| >3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* | Back alignment and structure |
|---|
| >2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A | Back alignment and structure |
|---|
| >3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A | Back alignment and structure |
|---|
| >3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A | Back alignment and structure |
|---|
| >3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} | Back alignment and structure |
|---|
| >1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* | Back alignment and structure |
|---|
| >1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A | Back alignment and structure |
|---|
| >4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* | Back alignment and structure |
|---|
| >3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... | Back alignment and structure |
|---|
| >3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* | Back alignment and structure |
|---|
| >1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} | Back alignment and structure |
|---|
| >3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A | Back alignment and structure |
|---|
| >2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* | Back alignment and structure |
|---|
| >3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* | Back alignment and structure |
|---|
| >2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A | Back alignment and structure |
|---|
| >4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} | Back alignment and structure |
|---|
| >3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} | Back alignment and structure |
|---|
| >3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 104 | ||||
| d1icpa_ | 364 | c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, O | 1e-39 | |
| d1q45a_ | 380 | c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, O | 2e-34 | |
| d1gwja_ | 374 | c.1.4.1 (A:) Morphinone reductase {Pseudomonas put | 5e-32 | |
| d1vyra_ | 363 | c.1.4.1 (A:) Pentaerythritol tetranirate reductase | 1e-30 | |
| d1oyaa_ | 399 | c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast | 7e-30 | |
| d1djqa1 | 340 | c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N- | 7e-16 | |
| d1ps9a1 | 330 | c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-ter | 1e-14 | |
| d1z41a1 | 337 | c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacill | 3e-14 |
| >d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Length = 364 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: FMN-linked oxidoreductases family: FMN-linked oxidoreductases domain: 12-oxophytodienoate reductase (OPR, OYE homolog) species: Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]
Score = 132 bits (333), Expect = 1e-39
Identities = 71/94 (75%), Positives = 82/94 (87%)
Query: 1 MKTVGEKSECPHSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDL 60
MKT EK EC SL+ MRKA+KGTF+VAGGYDREDGN+A+ E RADLV YGR F++NPDL
Sbjct: 271 MKTAWEKIECTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDL 330
Query: 61 PRRFEFNAPLNKYNRETFYVSDPVVGYTDYPFLD 94
P+RFE NAPLNKYNR+TFY SDP+VGYTDYPFL+
Sbjct: 331 PKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFLE 364
|
| >d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Length = 380 | Back information, alignment and structure |
|---|
| >d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Length = 374 | Back information, alignment and structure |
|---|
| >d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Length = 363 | Back information, alignment and structure |
|---|
| >d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Length = 399 | Back information, alignment and structure |
|---|
| >d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 340 | Back information, alignment and structure |
|---|
| >d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 330 | Back information, alignment and structure |
|---|
| >d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Length = 337 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| d1gwja_ | 374 | Morphinone reductase {Pseudomonas putida [TaxId: 3 | 99.87 | |
| d1q45a_ | 380 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 99.84 | |
| d1oyaa_ | 399 | Old yellow enzyme (OYE) {Lager yeast (Saccharomyce | 99.84 | |
| d1vyra_ | 363 | Pentaerythritol tetranirate reductase {Enterobacte | 99.84 | |
| d1icpa_ | 364 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 99.83 | |
| d1djqa1 | 340 | Trimethylamine dehydrogenase, N-terminal domain {M | 99.57 | |
| d1z41a1 | 337 | NADPH dehydrogenase NamA {Bacillus subtilis [TaxId | 99.56 | |
| d1ps9a1 | 330 | 2,4-dienoyl-CoA reductase, N-terminal domain {Esch | 99.56 | |
| d1ep3a_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 98.46 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 98.07 | |
| d1y0ea_ | 222 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 98.04 | |
| d1juba_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 97.83 | |
| d1vhna_ | 305 | Putative flavin oxidoreducatase TM0096 {Thermotoga | 97.74 | |
| d1yxya1 | 230 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 97.66 | |
| d1tv5a1 | 409 | Dihydroorotate dehydrogenase {Plasmodium falciparu | 97.64 | |
| d1f76a_ | 336 | Dihydroorotate dehydrogenase {Escherichia coli [Ta | 97.62 | |
| d1d3ga_ | 367 | Dihydroorotate dehydrogenase {Human (Homo sapiens) | 97.58 | |
| d2b4ga1 | 312 | Dihydroorotate dehydrogenase {Trypanosoma brucei [ | 97.42 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.24 | |
| d1p4ca_ | 353 | Membrane-associated (S)-mandelate dehydrogenase {P | 97.18 | |
| d1xi3a_ | 206 | Thiamin phosphate synthase {Archaeon (Pyrococcus f | 97.12 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.97 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.95 | |
| d1goxa_ | 359 | Glycolate oxidase {Spinach (Spinacia oleracea) [Ta | 96.93 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 96.91 | |
| d1tb3a1 | 349 | Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI | 96.9 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 96.74 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.69 | |
| d1vcfa1 | 310 | Isopentenyl-diphosphate delta-isomerase {Thermus t | 96.69 | |
| d2tpsa_ | 226 | Thiamin phosphate synthase {Bacillus subtilis [Tax | 96.42 | |
| d1kbia1 | 414 | Flavocytochrome b2, C-terminal domain {Baker's yea | 96.21 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.11 | |
| d1qopa_ | 267 | Trp synthase alpha-subunit {Salmonella typhimurium | 96.08 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.01 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 95.79 | |
| d1geqa_ | 248 | Trp synthase alpha-subunit {Archaeon Pyrococcus fu | 95.6 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 95.49 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 95.48 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 95.42 | |
| d1h1ya_ | 220 | D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa | 95.31 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 95.28 | |
| d1tqxa_ | 221 | D-ribulose-5-phosphate 3-epimerase {Plasmodium fal | 95.12 | |
| d1hg3a_ | 224 | Triosephosphate isomerase {Archaeon Pyrococcus woe | 95.03 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 95.0 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 94.89 | |
| d1jr1a1 | 378 | Inosine monophosphate dehydrogenase (IMPDH) {Chine | 94.87 | |
| d1rd5a_ | 261 | Trp synthase alpha-subunit {Maize (Zea mays) [TaxI | 94.82 | |
| d1q6oa_ | 213 | 3-keto-L-gulonate 6-phosphate decarboxylase {Esche | 94.67 | |
| d1w0ma_ | 226 | Triosephosphate isomerase {Thermoproteus tenax [Ta | 94.6 | |
| d1viza_ | 229 | PcrB protein homolog YerE {Bacillus subtilis [TaxI | 94.54 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 94.28 | |
| d1wv2a_ | 243 | Thiazole biosynthesis protein ThiG {Pseudomonas ae | 94.19 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 94.12 | |
| d1xm3a_ | 251 | Thiazole biosynthesis protein ThiG {Bacillus subti | 93.93 | |
| d2flia1 | 217 | D-ribulose-5-phosphate 3-epimerase {Streptococcus | 93.65 | |
| d1rpxa_ | 230 | D-ribulose-5-phosphate 3-epimerase {Potato (Solanu | 93.53 | |
| d2f6ua1 | 231 | (S)-3-O-geranylgeranylglyceryl phosphate synthase | 93.42 | |
| d1wa3a1 | 202 | KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | 93.37 | |
| d1znna1 | 254 | Pyridoxal biosynthesis lyase PdxS {Bacillus stearo | 93.08 | |
| d2czda1 | 206 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 93.06 | |
| d2cu0a1 | 368 | Inosine monophosphate dehydrogenase (IMPDH) {Pyroc | 93.05 | |
| d1pvna1 | 362 | Inosine monophosphate dehydrogenase (IMPDH) {Tritr | 92.87 | |
| d1vc4a_ | 254 | Indole-3-glycerophosphate synthase, IPGS {Thermus | 91.65 | |
| d1vhca_ | 212 | Hypothetical protein HI0047 {Haemophilus influenza | 91.33 | |
| d1piia2 | 254 | Indole-3-glycerophosphate synthase, IPGS {Escheric | 91.23 | |
| d1tqja_ | 221 | D-ribulose-5-phosphate 3-epimerase {Synechocystis | 90.71 | |
| d1eixa_ | 231 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 89.59 | |
| d1wbha1 | 213 | KDPG aldolase {Escherichia coli [TaxId: 562]} | 89.21 | |
| d1o5xa_ | 246 | Triosephosphate isomerase {Plasmodium falciparum [ | 88.73 | |
| d1qapa1 | 167 | Quinolinic acid phosphoribosyltransferase (Nicotin | 88.45 | |
| d1n55a_ | 249 | Triosephosphate isomerase {Leishmania mexicana [Ta | 88.27 | |
| d1i4na_ | 251 | Indole-3-glycerophosphate synthase, IPGS {Thermoto | 87.85 | |
| d1wbha1 | 213 | KDPG aldolase {Escherichia coli [TaxId: 562]} | 87.68 | |
| d1ea0a2 | 771 | Alpha subunit of glutamate synthase, central and F | 87.16 | |
| d1mxsa_ | 216 | KDPG aldolase {Pseudomonas putida [TaxId: 303]} | 86.82 | |
| d1ujpa_ | 271 | Trp synthase alpha-subunit {Thermus thermophilus [ | 86.75 | |
| d1mo0a_ | 257 | Triosephosphate isomerase {Nematode (Caenorhabditi | 86.73 | |
| d1mxsa_ | 216 | KDPG aldolase {Pseudomonas putida [TaxId: 303]} | 86.04 | |
| d1vhca_ | 212 | Hypothetical protein HI0047 {Haemophilus influenza | 86.03 | |
| d1kv5a_ | 249 | Triosephosphate isomerase {Trypanosoma brucei [Tax | 85.87 | |
| d1r2ra_ | 246 | Triosephosphate isomerase {Rabbit (Oryctolagus cun | 85.6 | |
| d1ofda2 | 809 | Alpha subunit of glutamate synthase, central and F | 85.07 | |
| d1dbta_ | 237 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 84.79 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 84.58 | |
| d1qpoa1 | 169 | Quinolinic acid phosphoribosyltransferase (Nicotin | 84.16 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 84.11 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 83.51 | |
| d1b9ba_ | 252 | Triosephosphate isomerase {Thermotoga maritima [Ta | 83.25 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 83.22 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 82.57 | |
| d1neya_ | 247 | Triosephosphate isomerase {Baker's yeast (Saccharo | 82.43 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 82.21 | |
| d1ytda1 | 270 | Nicotinate phosphoribosyltransferase Ta1145 {Therm | 81.57 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 81.22 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 80.39 | |
| d1t71a_ | 281 | Hypothetical protein MPN349 {Mycoplasma pneumoniae | 80.18 |
| >d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: FMN-linked oxidoreductases family: FMN-linked oxidoreductases domain: Morphinone reductase species: Pseudomonas putida [TaxId: 303]
Probab=99.87 E-value=3.4e-22 Score=153.72 Aligned_cols=84 Identities=45% Similarity=0.788 Sum_probs=79.2
Q ss_pred hHHHHHHHHcCCeEEEeCCCCHHHHHHHHHcCCCcEEecchHHhhCCcHHHHHhhCCCCCCCCccccccCCCCCCcccCC
Q 046574 12 HSLLLMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRFFLANPDLPRRFEFNAPLNKYNRETFYVSDPVVGYTDYP 91 (104)
Q Consensus 12 ~~~~~ir~~~~~pvi~~Ggi~~~~ae~~l~~g~~DlVa~gR~~lanPdl~~ri~~g~~l~~~d~~~~~~~~~~~gy~d~p 91 (104)
..++.+++.+++|||++|+++++.|+++|++|.+|+|++||++|+|||||+|+++|.+++++++.+||+.+ ..||+|||
T Consensus 286 ~~~~~i~~~~~~pvi~~G~i~~~~ae~~l~~g~aDlV~~gR~~iadPd~~~K~~~G~~l~~~~~~~~~~~~-~~g~~~~p 364 (374)
T d1gwja_ 286 GFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGA-EVGYTDYP 364 (374)
T ss_dssp THHHHHHHHCCSEEEEESSCCHHHHHHHHHTTSCSEEEESHHHHHCTTHHHHHHHTCCCCCCCGGGSSSSS-STTTTCCC
T ss_pred HHHHHHHHHcCCCEEEECCcCHHHHHHHHHcCCCcEehhhHHHHHCccHHHHHHcCCCCCCCChhhccCCC-CCCcCCCC
Confidence 46778999999999999999999999999999999999999999999999999999999999999999876 69999999
Q ss_pred CCCCc
Q 046574 92 FLDTS 96 (104)
Q Consensus 92 ~~~~~ 96 (104)
++++.
T Consensus 365 ~~~~~ 369 (374)
T d1gwja_ 365 FLDNG 369 (374)
T ss_dssp CCCCS
T ss_pred Ccchh
Confidence 99753
|
| >d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} | Back information, alignment and structure |
|---|
| >d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} | Back information, alignment and structure |
|---|
| >d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} | Back information, alignment and structure |
|---|
| >d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|