Citrus Sinensis ID: 046579


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------
MPPTKRTKRNLTITITSSSNHHYQASASVETIINNDDLLTEILLCLPIKSLLKFKAVSKHWLSLISNPIFSHRLRLVRKLISGLFVRRFTLRVNNPEYDFINLESNPSRAPFKSLTFVNDSYGIKVLQSCNGLLLCSSSRAYQPRRNYYVYNPTNKQYTILPRLHVDRGIFRSIFGVNLAFDPSKSAHYKVICVRNCDSLRDGHYQIEIYSSKTGPWRLSGGSFTAPSVINFRGGVFWNGAIHWVSTHGSSLYFDVDQEKLREMPMPPIPDEWEERRHQYFGESRGHLHLIEIYGPCTALFNVYEMKTDYSGWFVKYRVDLGGVTYVFPEMIRTYLDPEDLHYYGYSILCVVREENDDDSYLVLHLPKKAVRYNLKDRTFKKLHDVAPAGNQAEDESALQFRWFDAFQYTESLACV
cccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccEEEEEEccccccccCEECcccccccccccccccccccccEEEEEEEccEEEEEcccccccccEEEEECcccccEEEccccccccccccccEEEEEEEcccccccEEEEEEEECccccccEEEEEEEEcccccEEEccccccccEEEEccccEEEcccEEEEECccEEEEEEccccCEEECcccccccccccccccEEEECccEEEEEEEEcccccEEEEEEEcccccEEEEEEEEEcccCECcccccCCccccccccccccEEEEEEEEECcccCEEEEEEcccEEEEEEccccCEEEEECcccccccccccccccccccccccEEcccEEc
*****************************ETIINNDDLLTEILLCLPIKSLLKFKAVSKHWLSLISNPIFSHRLRLVRKLISGLFVRRFTLRVNNPEYDFINLESNPSRAPFKSLTFVNDSYGIKVLQSCNGLLLCSSSRAYQPRRNYYVYNPTNKQYTILPRLHVDRGIFRSIFGVNLAFDPSKSAHYKVICVRNCDSLRDGHYQIEIYSSKTGPWRLSGGSFTAPSVINFRGGVFWNGAIHWVSTHGSSLYFDVDQEKLREMPMPPIPDEWEERRHQYFGESRGHLHLIEIYGPCTALFNVYEMKTDYSGWFVKYRVDLGGVTYVFPEMIRTYLDPEDLHYYGYSILCVVREENDDDSYLVLHLPKKAVRYNLKDRTFKKLHDVAPAGNQAEDESALQFRWFDAFQYTESLACV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPTKRTKRNLTITITSSSNHHYQASASVETIINNDDLLTEILLCLPIKSLLKFKAVSKHWLSLISNPIFSHRLRLVRKLISGLFVRRFTLRVNNPEYDFINLESNPSRAPFKSLTFVNDSYGIKVLQSCNGLLLCSSSRAYQPRRNYYVYNPTNKQYTILPRLHVDRGIFRSIFGVNLAFDPSKSAHYKVICVRNCDSLRDGHYQIEIYSSKTGPWRLSGGSFTAPSVINFRGGVFWNGAIHWVSTHGSSLYFDVDQEKLREMPMPPIPDEWEERRHQYFGESRGHLHLIEIYGPCTALFNVYEMKTDYSGWFVKYRVDLGGVTYVFPEMIRTYLDPEDLHYYGYSILCVVREENDDDSYLVLHLPKKAVRYNLKDRTFKKLHDVAPAGNQAEDESALQFRWFDAFQYTESLACV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box protein At5g07610 probableQ9FLS0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3II7, chain A
Confidence level:confident
Coverage over the Query: 128-332,344-390
View the alignment between query and template
View the model in PyMOL
Template: 2AST, chain B
Confidence level:confident
Coverage over the Query: 29-71
View the alignment between query and template
View the model in PyMOL