Citrus Sinensis ID: 046691

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--

MDYDFRNRANSSYSLYGPPPSASSGGSAPSHHPMYGSSLYPRIGQQGSGHSMGPPVSRTSSYNASPSPSSSSSGLGIRVALKPEYRITPPPTLSPQVGDIPRSNFHFDFDFERRVLAEAEKENQNWSRLGMENIPSKNEPTSSVGSGSDPVVSRYIALGLNREAVHIAVANYGDNPTKVREFANGYTILREMGFSSNNVAEVLIMYENDTDKALAHLLGSSA

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHcccc

*****************************************************************************************************RSNFHFDFDFERRVL**********************************VVSRYIALGLNREAVHIAVANYGDNPTKVREFANGYTILREMGFSSNNVAEVLIMYENDTDKALAHLLGS**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AE4, chain A
Confidence level:very confident
Coverage over the Query: 146-217
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3dzy, chain A		probable	Alignment \| Template Structure